SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011936 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011936
Domain Number 1 Region: 4-184
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.14e-56
Family BAR domain 0.000000596
Further Details:      
 
Domain Number 2 Region: 240-319
Classification Level Classification E-value
Superfamily SH3-domain 7.61e-21
Family SH3-domain 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011936   Gene: ENSTTRG00000012579   Transcript: ENSTTRT00000012579
Sequence length 323
Comment pep:novel genescaffold:turTru1:GeneScaffold_1611:101000:160916:1 gene:ENSTTRG00000012579 transcript:ENSTTRT00000012579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEGKLDDEFLDMERKIDVTNKAVAEILSKATEYLQPNPAYRAKLGMLNTVSKIRGQVKTT
GYPQTEGLLGDCMLKYGKELGEGSTFGNALIEVGESMKLMAEVKDSLDINVKQTFIDPLQ
LLQDKDLKEIGXXXKRLEGRRLDYDYKKKRVGKIPDEEVRQAVEKFEESKELAERSMFNF
LENDXXXXXXXXXXXXXXXXXXXXXXXXXQELQSKLQMRISAASSVPRREYKPRPMKRSP
SALNGVSATSSAKTTGSHIPMDQPCCRGLYEFEPENQGELGFKEGDIITLTNQIDENWYE
GVLHGESGFFPINYVEVIVPLPQ
Download sequence
Identical sequences ENSTTRP00000011936 ENSTTRP00000011936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]