SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011995 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011995
Domain Number 1 Region: 892-946
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.7e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 976-1031
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000634
Family Classic zinc finger, C2H2 0.039
Further Details:      
 
Domain Number 3 Region: 562-610
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000048
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 4 Region: 729-778
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000728
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 5 Region: 650-701
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000111
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 6 Region: 1021-1072
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000527
Family Classic zinc finger, C2H2 0.046
Further Details:      
 
Domain Number 7 Region: 937-978
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000104
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 8 Region: 819-869
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000868
Family Classic zinc finger, C2H2 0.038
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000011995
Domain Number - Region: 245-360
Classification Level Classification E-value
Superfamily SET domain 0.00105
Family Histone lysine methyltransferases 0.052
Further Details:      
 
Domain Number - Region: 621-644
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00607
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number - Region: 375-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00956
Family Classic zinc finger, C2H2 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011995   Gene: ENSTTRG00000012632   Transcript: ENSTTRT00000012642
Sequence length 1330
Comment pep:novel genescaffold:turTru1:GeneScaffold_1647:8530:65320:-1 gene:ENSTTRG00000012632 transcript:ENSTTRT00000012642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRPPARSPPGALVAEVPRDVTLPRPAQPPGANGEGPWTPPLPAVSKAEFGLGNLDRAETK
LNVLRPHEASCNVKNHVFSQFSLGLCIVCYSFFKLPGWNGAEGVWNRHSWSAGLCTSPER
YLVIHSGLVGVGCRKDVLVVVMAEDGNEEIMFIWCEDCSQYHDSECPELGPVVMVKDSFV
LSRARPRPAVQAPTVGKGRAGSQAKVWQLLDAPDLVRGLRLCQCTFPWGGGAQPHLPRRS
WSSLPSNLEIRRLEDGAEGVFAVTQLVKRTQFGPFESRRVAKWEKESAFPLKVFQKDGHP
VCFDTSNEDDCNWMMLVRPAAEPGHQNLTAFQHGSDVYFTTSRDIPPGTELRVWYAAFYA
KRMDKPMLRQACPGLHAAGTPESSTPVEAEPSRWVCKVCSAAFLELQLLNEHLLGHLEQS
RSVPPAGQQDSAAEKEADVPRGEPPAVPKSVSAAKEQKKKPRRGRKPKASKPEQPLVIVE
GEEPAEQVAEIMSEVEPVAASPDERIMELVLGKLAATPSDASSVPKFPHHQSGSITLKRS
LILSSRHGIRRKLVRQLGEHRRVYQCSICSKVFQNSSNLSRHVRSHGDKLFKCEECTKLF
SRKESLKQHVSYKHSRNEVDSEYRYRCGTCEKTFRIQSALEFHNCRTDDKTFQCEMCFRF
FSTNSNLSKHKKKHGDKKFACEVCNKMFYRKDVMLDHQRRHLEGVRRVKREDAEAGGAEN
LVRYRKEPSGCPVCGKVFSCRSNMNKHLLTHGDKKYTCEICGRRFFRVDVLRDHIHVHFK
DIALMDDQQREEFIGKIGISSEENDGTSDESADSEPHKYSCKRCQLTFGRGKEYLKHIME
VHKEKGYGCSTCHRRFALKATYHAHMVIHRENLPDPNVQKYIHPCEICGRIFNSIGNLER
HKLIHTGVKSHACEQCGKSFARKDMLKEHMRVHDNIREYLCAECGKGMKTKHALRHHMKL
HKGIKEYECRECHRKFAQKVNMLKHYKRHTGIKDFMCELCGKTFSERNTMETHKIIHTVG
KQWTCSVCDKKYVTEYMLQKHVQLTHDKVEAQSCQLCGTKVSTRASMSRHMRRKHPEVLA
VRIDDLDHLPETTTIDASSIGIVQPELSLGQEDLAEGKHVKATRRTHKRKQKPEDEAGAT
GPEEATFSEFSEKEATFSGGVGDETSSAVQSIQQVVVTLGDPNVTTPSSSVGLTNITVTP
ITTAAGTQFTNLQPVAVGHLTTPERQLQLDNSILTVTFDTVSGSAMLHNRQNDLQIHPQP
EASNPQSVAHFINLTTLVNSITPLGSQLGEQPPLTWRAVPQTDVLPAPAPAPQAAQPPVP
AEQQPQMYSY
Download sequence
Identical sequences ENSTTRP00000011995 ENSTTRP00000011995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]