SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012365 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012365
Domain Number 1 Region: 1-149
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.21e-24
Family Voltage-gated potassium channels 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012365   Gene: ENSTTRG00000013034   Transcript: ENSTTRT00000013031
Sequence length 217
Comment pep:novel genescaffold:turTru1:GeneScaffold_1405:602281:607369:1 gene:ENSTTRG00000013034 transcript:ENSTTRT00000013031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YGHTVPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRVTIHVTRRPVLYFHVRWGFSKQAV
AIVHAVLLGVITVSCFFFIPAAVFSLLEDDWNFLESFYFCFISLSTIGLGDYVPGEGYNQ
KFRELYKIGITCYLLLGLIAMLVVLETFCELHELKKFRKMFYVKKDKEEDQVHIIEHDQM
SFSSITDQAASVKEDQKQDEPFVPPQSPAFADGAANQ
Download sequence
Identical sequences ENSTTRP00000012365 ENSTTRP00000012365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]