SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012399 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012399
Domain Number 1 Region: 461-518
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.41e-27
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 2 Region: 321-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.33e-26
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 3 Region: 517-574
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-25
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 4 Region: 377-434
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.35e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 5 Region: 238-294
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.03e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 6 Region: 2-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.4e-23
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 7 Region: 587-639
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-20
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 8 Region: 199-251
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-19
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 9 Region: 424-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000468
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 10 Region: 284-316
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000104
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012399   Gene: ENSTTRG00000013069   Transcript: ENSTTRT00000013067
Sequence length 645
Comment pep:novel genescaffold:turTru1:GeneScaffold_2869:32907:37366:1 gene:ENSTTRG00000013069 transcript:ENSTTRT00000013067 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EQVTFEDVVVEFTWEEWGQLEPAQRTLYRDVMLETFGLLASVGHWLPKPDVISLLEHEAE
LWVVDKGAPRGVCTDFETRQTKLSTVKQDITEEIPNNALVERFLWEGLWNSKGENAEGHW
EQGHKRPDSHVVQSAFMPVKTPTQEKQQGNGFGENLSLRPDLSTRPMTPKRQGPPVWGTH
GKREDLDSDTQQKTCAKEKPYRCQECGKAFSHSSALIEHHRTHTGERPYECHECGKGFRN
SSALTKHQRIHTGEKPYKCTQCGRTFNQIAPLIQHQRTHTGEKPYECSECGKSFSFRSSF
SQHERTHTGEKPYTCSQCGKAFRQSIHLTQHLRIHTGEKPYQCGECGKAFSHSSSLTKHQ
RIHTGEKPYECQACGKAFTQITPLIQHQRTHTGERPYECSECGKAFSQSTLLTEHRRIHT
GEKPYGCNECGKTFSHSSSLSQHERTHTGEKPYSCSQCGKAFRQSTHLTQHQRIHTGEKP
YECSECGKAFSHSSSLTKHQRIHTGEKPYECNECGRAFSQLAPLIQHQRIHTGEKPYECN
ECGRAFSQSSLLIEHQRIHTKEKPYGCNECGKSFSHSSSLSQHERTHTGEKPYECQDCGK
SFRQSTHLTQHRRIHTGEKPYECRDCGKAFTHSSSLTKHQRTHAG
Download sequence
Identical sequences ENSTTRP00000012399 ENSTTRP00000012399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]