SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012675 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012675
Domain Number 1 Region: 415-472
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.64e-25
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 2 Region: 247-304
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 3 Region: 499-551
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.23e-22
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 360-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.77e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 303-360
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.27e-20
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 5-49
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-19
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 7 Region: 210-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.04e-17
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 8 Region: 462-494
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000635
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000012675
Domain Number - Region: 188-220
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0107
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012675   Gene: ENSTTRG00000013362   Transcript: ENSTTRT00000013360
Sequence length 551
Comment pep:novel scaffold:turTru1:scaffold_109204:69987:111574:-1 gene:ENSTTRG00000013362 transcript:ENSTTRT00000013360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSQLTLNDVAIEFSPEEWECLDPAQRALYRDVMLETYRNLISVDISHIHVIKKLQLKS
NTDKGGVFQTLMLERHESQGIKHFYLPEIQENTYDHGFQWRDDGRSYKNIPISCHQDVTD
RSPHGGRDAKNKPIGNRLVLSLQGELHMFKSKQKIDEFNKAVKSISSSSSFSPLQGISPP
VQTNISNRYGSDFMHPSILTQDQSPHREVPYKCNECGKTFHQVSNLRSHQRIHIGKKLHK
CDVCDKVFCRNSYLVIHQRVHTGEKPYKCNECGKVFDKKGSLAVHQRIHTGEKPYKCNEC
GRTFPIGSYLKRHQITHIQEKLYKCDICGKVYRQNLSLQRHQEIHTGEKTYKCNVCGKVY
GQNSYLKCHRRIHTGEKPYKCNLCGKTFFFKTGLRKHEIIHTGAKPYKCDVCGKVFNQKS
VLVNHQRIHTGEKPHKCNECGKFFREKQTLRRHQQVHTGEKPYKCNECGKAFSMKGNLAA
HQRIHTEEKPYKCNSCGKVFREKPALRRHQRIHTGEKPYKCNECGRAFREKPALRRHQRI
HTGEKPYKCNE
Download sequence
Identical sequences ENSTTRP00000012675 ENSTTRP00000012675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]