SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012789 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012789
Domain Number 1 Region: 109-249
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000119
Family Phosphotyrosine-binding domain (PTB) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012789   Gene: ENSTTRG00000013484   Transcript: ENSTTRT00000013479
Sequence length 272
Comment pep:novel scaffold:turTru1:scaffold_106740:40054:294494:-1 gene:ENSTTRG00000013484 transcript:ENSTTRT00000013479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KLPAAERRAASPSQPPTPTPRRSPAPGRTSRGRPPTPGAIDSLASVSSARPRGWKMWQPA
TERLQHFQTMLKSKLNVLTLKKEPLPAVIFHEPEAIELCTTTPLMKTRTHSGCKVTYLGK
VPTTGMQFLSGCTEKPVIELWKKHTLAREDVFPANALLEIRPFQVWLHHLDHKGEATVHM
DTFQVARIAYCTADHNVSPDIFAWVYREINDDLSYQMDCHAVECESKLEAKKLAHAMMEA
FKKTFHSMKSDGRIHRNSSSEEVSQELESDDG
Download sequence
Identical sequences ENSTTRP00000012789 ENSTTRP00000012789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]