SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012793 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012793
Domain Number 1 Region: 36-497
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.68e-108
Family L-arabinose binding protein-like 0.0000000102
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000012793
Domain Number - Region: 504-547
Classification Level Classification E-value
Superfamily TNF receptor-like 0.004
Family TNF receptor-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012793   Gene: ENSTTRG00000013480   Transcript: ENSTTRT00000013483
Sequence length 876
Comment pep:novel genescaffold:turTru1:GeneScaffold_3409:278081:382061:1 gene:ENSTTRG00000013480 transcript:ENSTTRT00000013483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMLTRLQVLTLALFSKGLFLSLGDHNFLRREIKIEGDLVLGGLFPIKEKGTGTEECGRI
NEDRGIQRLEAMLFAIDEINKDNYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLTKV
DEAEYMCPDGSYAIQENIPLFIAGVIGGSYSSVSIQVANLLRLFQIPQISYASTSAKLSD
KSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFEQEARLRNIC
IATAEKVGRSNIRKSYDSVIRELLQKPNARVVVLFMRSDDSRELIAAASRANASFTWVAS
DGWGAQESIVKGSEHVADGVITLELASQRIRQFDRYFQSLSPYSNHRNPWFRDFWEQKFC
SFNKHNHRRSCDKHLVIDSSNYEQESKIMFVVNAVYAMAHALHKMQRTLCPNTTKLCDAM
RILDGKKLYKDYLLKINFTAPFNPNKGADSIVKFDTFGDGMGRYNVFNFQYMGGKYSYLK
VGHWAETLSVDVDSIHWSRNSIPTSQCSDPCAPNEMKNMQPGDVCCWICIPCEPYEYLAD
EFTCMDCGLGQWPTADLSGCFDLPEDYIRWQDAWAIGPVTIACLGFMCTCVVVTVFIKHN
NTPLVKASGRELCYILLFGVGLSYCMTFFFISKPSPVICALRRLGLGTSFAVCYSALLTK
TNCIARVFDGVKNGAQRPKFISPSSQVFICLGLILVQIVVVSVWLILEVPGTRRYTLPEK
RETVILKCNVKDSSMLISLTYDVVLVILCTVYAFKTRNCPEDSNEAKFIGFTMPTCIIWL
AFLPXXXXXXXXXXVQTTTMCISVSLSGFVVLGCLFAPKVHIILFQPQKNVVTHRLHLNR
FSVSGTGTTYSQSSASTYVPTVCNGREVLDSTTSSL
Download sequence
Identical sequences ENSTTRP00000012793 ENSTTRP00000012793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]