SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012947 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012947
Domain Number 1 Region: 182-413
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.86e-58
Family Voltage-gated potassium channels 0.00075
Further Details:      
 
Domain Number 2 Region: 39-144
Classification Level Classification E-value
Superfamily POZ domain 1.66e-32
Family Tetramerization domain of potassium channels 0.00000522
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012947   Gene: ENSTTRG00000013649   Transcript: ENSTTRT00000013646
Sequence length 645
Comment pep:novel genescaffold:turTru1:GeneScaffold_565:3707:8915:-1 gene:ENSTTRG00000013649 transcript:ENSTTRT00000013646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGVATWLPFARAAAVGWLPLAQQPLPPAPGVKATRGDEVLVVNVSGRRFETWKNTLDR
YPDTLLGSSEKEFFYDADSGEYFFDRDPDMFRHVLNFYRTGRLHCPRQECIQAFDEELAF
YGLVPELVGDCCLEEYRDRKKENAERLAEDEEAEQAGDGPSLPAGSSLRQQLWRAFENPH
TSTAALVFYYVTGFFIAVSVIANVVETIPCRGPARRPPREQPCGERFPLAFFCMDTACVL
IFTGEYLLRLFAAPSRCRFLRSVMSLIDVVAILPYYIGLLVPKNEDVSGAFVTLRVFRVF
RIFKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGTNKTNFTSIP
AAFWYTIVTMTTLGYGDMVPSTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQR
ADKRRAQQKVRLARIRLAKSGTTNAFLQYKQNGGLEDSSSGEEQAPCVRNRSAFEQQHHH
LLHCLEKTTCHEFTDELTFSEALGAVSLGGRTSRSTSVSSQPVGPGSLLSSCCPRRAKRR
AIRLANTSVSHGSMQELDTLAGLQRSAPQSRSSLNAKPHDSLDLNCDSRDFVAAIISIPT
PPANTPDESQPSSPGGGGSGASSTLRNSSLGTPCLLPETVKISSL
Download sequence
Identical sequences ENSTTRP00000012947 ENSTTRP00000012947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]