SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013273 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013273
Domain Number 1 Region: 627-801
Classification Level Classification E-value
Superfamily PH domain-like 1.01e-35
Family Phosphotyrosine-binding domain (PTB) 0.0063
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000013273
Domain Number - Region: 595-634
Classification Level Classification E-value
Superfamily SH3-domain 0.0066
Family SH3-domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013273   Gene: ENSTTRG00000013997   Transcript: ENSTTRT00000013996
Sequence length 813
Comment pep:novel genescaffold:turTru1:GeneScaffold_491:223618:233311:1 gene:ENSTTRG00000013997 transcript:ENSTTRT00000013996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADRAEMFSLSTFHSLSPPGCRPPQDISLEEFDDEDLSEITDDCGLGLSYDSDHCEKDSL
SLGRSEQPHPICSFQDDFQEFEMIDDNEEEEDDEEEEEEEEEEAEGEVEGGGPGSAARAR
QPLIPSPSLEEPHKHRPTTLHLTTLGAQDSLNNNGGFAPGPPASRQETVLCPPAQEPLRE
PPAPLPPTDRSPCGAQSPVHPGCDSEGNQPARPLAPGGASPSSDPGIEADLGSGSSGGRG
GRRSSQELSSPGSDSEDAGGARLGRMISSISETELERSSDDGGSSSGRSSHLTNSIEEAS
SPASEPEPEPPCEPPRRPAFLPVGPDDTNSEYESGSESEPDLSEDADSPWLLSNLVSRMI
SEGSSPIRCPGQCLSPAPRPAGECASPVGEAPEAAAGPGVELVDMETLCGPPPPEPSAPR
PGPAQPGPCLFLSNPTRDTITPLWAAPGRPARPGRACSAACSEEDDEDEEEEDEAEPEAA
PLGGRGTGAAPDASLVYDAVKYTLVVDEHTQLELVSLRRCARLGEDSGDSGGEACEYDAG
AAPLGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTESFGLFSCLVNGEEREQTHR
AVFRFIPRHPDELELDVDDPVLVEAEEDDFWFRGFNMRTGERGVFPAFYAHAVPGPAKDL
LGSKRGPCWVERFDVQFLGSVEVPCHQGNGILCAAMQKIATARKLTVHLRPPASCDLEIS
LRGVKLSLSGGPEFQHCSHFFQMKNISFCGCHPRNSCYFGFITKHPLLSRFACHVFVSQE
SMRPVAQSVGRAFLEYYQRHLEYACPTEDIYLE
Download sequence
Identical sequences ENSTTRP00000013273 ENSTTRP00000013273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]