SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013370 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013370
Domain Number 1 Region: 8-104
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.91e-21
Family Ubiquitin-related 0.0000244
Further Details:      
 
Domain Number 2 Region: 689-698,820-861
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000288
Family Formin homology 2 domain (FH2 domain) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013370   Gene: ENSTTRG00000014099   Transcript: ENSTTRT00000014099
Sequence length 1163
Comment pep:novel genescaffold:turTru1:GeneScaffold_3472:104435:114706:-1 gene:ENSTTRG00000014099 transcript:ENSTTRT00000014099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPNDSTSTTMEEPDSLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLI
YQGRVLQDDKKLQEYNVGGKVIHLVERAPPQTQLPSGASSGTGSASATHGGGPPPGTRGP
GASVHDRNANSYVMVGTFNLPSDGSAVDVHINMEQAPIQSEPRVRLVMAQHMIRDIQTLL
SRMECRGGPQAQQSQAPPQTPAVASEPVALSSPTSEPVESEVPPREPMEAEEVEERAPAQ
SPELSPSGPAPAGPAPAPDTNAPNHPSPAEYVEVLQELQRLESRLQPFLQRYYEVLGAAA
TTDYNNNQEGREEDQRLINLVGESLRLLGNTFVALSDLRCNLACAPPRHLHVVRPMSHYT
TPMVLQQAAIPIQINVGTTVTMTGNGTRPPPTPNAEAPPPGPGQASSLAPSSTTVESLAE
GAPSLGPAPPPTASHPRVIRISHQSVEPVVMMHMNIQDSGTQPGGVPSAPTGPLGPPGHG
QTLGSTHIQLPSLPPEFMHAVAHQITHQAMVAAVASAAAGQVPGFPTAPTRVVIARATPP
QARPSHPGGPPVSGALPGAGLGTNASLAQMVSGLVGQLLMQPVLVAQGTPGMAPPPAPAT
ASASAGTTNTATTAGPAPGGPAQPPPPQPSASDLQFSQLLGNLLGPAGPGAGGPGMASPT
ITVAMPGVPAFLQGMTDFLQATQTAAPPPPPPPPPPPPPAPEQQTAPPPGSPSGGAGSPG
GLGPESLPLEFFTSVVQGVLSSLLGSLGARAGSSESIAAFIQRLSGSSNIFEPGADGALG
FFGALLSLLCQNFSMVDVVMLLHGHFQPLQRLQPQLRSFFHQHYLGGQEPTPGNIRTATH
TLITGLEEYVRESFSLVQVQPGVDIIRTNLEFLQEQFNSIAAHVMHCTDSGFGARLLELC
NQGLFECLALNLHCLGGQQMELAAVINGRIRRMSRGVNPSLVSWLTTMMGLRLQVVLEHM
PVGPDAILRYVRRVGDPPQTLPEEPMEIQGSERTPPEPQRENASPAPGTTAEEAMSRGPP
PAPEGGSRDEQDGASAETEPWAAAVPPEWVPIIQQDIHSQRKVKPQPPLSDAYLSGMPAK
RRKTMQGEGPQLLLSEAVSRAAKAAGARPLTSPESLSRDLEAPEVQESYRQQLRADIQKR
LQEDPNYSPQRFPNAHRAFAEDP
Download sequence
Identical sequences ENSTTRP00000013370 ENSTTRP00000013370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]