SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013684 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013684
Domain Number 1 Region: 151-243
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000107
Family cAMP-binding domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013684   Gene: ENSTTRG00000014430   Transcript: ENSTTRT00000014430
Sequence length 365
Comment pep:novel genescaffold:turTru1:GeneScaffold_93:245758:261549:-1 gene:ENSTTRG00000014430 transcript:ENSTTRT00000014430 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSNGSAVGQLLWSRPLCVGWRRDQEGAVYHLATCLLLLGFMGGSGVYGCFYLFGFLGTG
YLCCVLWGWFDACGLDIVLWSVLLATACVLQLAHLVYRLREDTLPEEFELLYKTLCLPLQ
VPLPVYKEIVRCCEEQVLTLATEQTYAVEGETPIDRLSLLLSGRVRVSQDGQFLHYVFPY
QFMDSPEWESLHPSTEGVFQVTLTAETECSYISWPRKSLHLLLAKERYISRLFSALLGYD
ISEKLYALNDKLFAKFRLRFDIRLPSLYHVLGAAAPDAGPESQKDDKDVREPAASPSPQA
LPTSVQQTPPSSPPPASTNPPAPPPWVRMSRPDSSVLASRTPLQSYSQVMSRGRAPLAPT
LTPEL
Download sequence
Identical sequences ENSTTRP00000013684 ENSTTRP00000013684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]