SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013766 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013766
Domain Number 1 Region: 742-970
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-59
Family DBL homology domain (DH-domain) 0.00000000103
Further Details:      
 
Domain Number 2 Region: 349-525
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.06e-56
Family Regulator of G-protein signaling, RGS 0.0000000218
Further Details:      
 
Domain Number 3 Region: 973-1107
Classification Level Classification E-value
Superfamily PH domain-like 7.95e-44
Family Pleckstrin-homology domain (PH domain) 0.000000265
Further Details:      
 
Domain Number 4 Region: 27-120
Classification Level Classification E-value
Superfamily PDZ domain-like 8.02e-21
Family PDZ domain 0.024
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000013766
Domain Number - Region: 148-158
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0288
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013766   Gene: ENSTTRG00000014519   Transcript: ENSTTRT00000014519
Sequence length 1548
Comment pep:novel genescaffold:turTru1:GeneScaffold_1301:287257:361319:-1 gene:ENSTTRG00000014519 transcript:ENSTTRT00000014519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVRLPQSIDRLSSLSLGDSAPERKSPSHHRQPSDTSETTGLVQRCVIIQKDQHGFGFTV
SGDRIVLVQSVRPGGAAMKAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLLG
SSPSSIGVSGPQQEPVPAGAPRVTPVIPPPPPPPPLPPPQRITGPKPLQDPEFQKHATQI
LRNMLRQEEKELQRICEVYSRNPGSLLEEQIEGARRRVTQLQLKIQQETGGLVDILPLYG
DTSQRSSEGRLSLDSQEGDSGLDSGTERFPSLGESLVNRNSVLSDPGPDSPRTSPVIMAR
VAQHHRRQGSDALVPPSCDQAVDQSPKPLIIGPEEDYDPGYFNNESDIIFQDFEKLKSRP
AHLGVFLRYIFSQADPSPLLFYLCAEVYQQTNPKDSRSLGKDIWNIFLEKNAPLRVKVPE
MLQAEIDLRLRNGEDVRAVLCEAQEAAMPEIQEQIHDYRTKRTLGLGSLYGENDLLDLDG
DPLRERQVAEKQLAALGDILSKYEEDRSAPMDFALNTYMSHAGIRLREARPSNTAEKAQS
APDKDSSNSKKEKDALEDKKRNPILKYIGKPKSSSQSTFHIPLSPVEVKPGNVRNIIQHF
ENNQQYDAPEPGMQRLSTGSFPEDLLESDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLENPTPPFTPKMGRRSIESPSLGFCTDAL
LPNLLEDDLGQLSDLEPEPDAQNWQHTVGKDVVAGLSQREIDRQEVINELFVTEASHLRT
LRVLDLIFYQRMKKEGLLPREELARLFPNLPELIEIHNSWCEAMRKLREEGPIIKEVSDL
MLARFDGPAREELQQVAAQFCSYQSIALELIKTRQRKESRFQLFMQEAESHPQCRRLQLR
DLIISEMQRLTKYPLLLENIIKHTEGGTSEHEKLCRARDQCREILKYVNEAVKQTENRHR
LEGYQKRLDTTSLERASNPLAAEFKSLDLTTRKMIHEGPLTWRISKDKTLDLHVLLLEDL
LVLLQKQDEKLLLKCHSKTAVGSSDSKQTFSPVLKLNAVLVRSVATDKRAFFIICTSELG
PPQIYELVALTSSDKNTWMELLEEAVRNATRHPGAAPKPVHPPPSGPQEPAHQSPTPSRE
GLDDSEVFRSEPEPETVPGGTGPQQRVKGKHPVLLEGPKQEGSIEEEELGTLPHPSASLD
GENRGSRTRDPILLPLPGPLFMEGLADAALEDVENLRHLILWSLLPGRPMDPQTSGEPED
DLTPTPSVISITSHPWDPGSPGRAPTGGEGDSAPLSGPERGQQEDTALCSLEHLPPRTRN
SGIWESPELDRNPEEEASSTEATGSYKVVRKAEVAGSKVVPALPESGQSEPEPPEVEGGA
KATGNCFYVSMPAGPLDSSTDPSGARVGPSQPDGLPAWQPAPRPALREGNEDQRRLGRSP
PSLALRDMGMIFRTIEQLTVKLNRLKDMELAHKELLRSLGGESSGGTTPVGGFHTEAARW
IDSSLSPPAKEHLASDSRDSCELGPCPEDGHNAPLEDGPADSATSPGL
Download sequence
Identical sequences ENSTTRP00000013766 ENSTTRP00000013766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]