SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013874 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013874
Domain Number 1 Region: 136-471
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.49e-66
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000445
Further Details:      
 
Domain Number 2 Region: 38-121
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000664
Family Anticodon-binding domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013874   Gene: ENSTTRG00000014631   Transcript: ENSTTRT00000014631
Sequence length 477
Comment pep:novel genescaffold:turTru1:GeneScaffold_994:288964:423916:-1 gene:ENSTTRG00000014631 transcript:ENSTTRT00000014631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGARCLLRALRSCSSAPCPGHKPSAKLSVRDALGAQNASGERVKVQGWIRSVRSQKEVL
FLHVNDGSSLESLQVVADSSFDSRELAFGSSVEVQGQLVKSLSKRQNVELKAEKIEVVGN
CDAKAFPFKYKERHPLEYLRQYPHLRCRTNVLGSILRVRSEATAAIHSFFKDSGFVHIHT
PVITSNDCEGAGELFQVTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAFTQVFTFGP
TFRAENSQSRRHLAEFYMVEAEISFLESLQDLMQVMEGLFKTTTMTVLSNCPEDVELCHK
FIAPGQKDRLEHMLKNNFLIISYTEAVEILKQASQNFTFTPEWGADLHTEHEKYLVKHCG
DTPVFVINYPLALKPFYMRDNEDSPQHTVAAGDLLVPGVGELFGGSLREERYHFLEQRLA
RSGLTEAYQXXXXXXXXXXXXXXXXGMGFERYLQCILGIDNIKDVIPFPRFTHSCLL
Download sequence
Identical sequences ENSTTRP00000013874 ENSTTRP00000013874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]