SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013900 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013900
Domain Number 1 Region: 316-679
Classification Level Classification E-value
Superfamily SIS domain 2.88e-89
Family double-SIS domain 0.00000185
Further Details:      
 
Domain Number 2 Region: 1-206,247-291
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 4.77e-52
Family Class II glutamine amidotransferases 0.0000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013900   Gene: ENSTTRG00000014658   Transcript: ENSTTRT00000014658
Sequence length 679
Comment pep:novel genescaffold:turTru1:GeneScaffold_1268:10167:43198:-1 gene:ENSTTRG00000014658 transcript:ENSTTRT00000014658 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFAYMNYRVPRTLNEIFETLIKGLHRLDYRGYDSAGVAIDGNNNEVKERHIQLVKKRGNV
KALDEELYKQDSMDLKVEFETHFGIAHTRWATHGVPNAVNSHPQRSDKGNEFVVIHNGII
TNYKDLRKFLESKGYEFESETDTETIAKLIKYVFDNRETEDITFSTLVERVIQQLEGAFA
LVFKSIHYPGEAVATRRGSPLLIGVRSKYKLSTEQIPILYRTRNIENVKNICKTRMKRLD
SSTCLHAVGDKAVEFFFASDASAIIEHTNRVIFLEDDDIAAVADGKLSIHRVKRSASDDP
SRAIQTLQMELQQIMKGNFSAFMQKEIFEQPESVFNTMRGRVNFETNTVLLGGLKDHLKE
IRRCRRLIVIGCGTSYHAAVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFFISQ
SGETADTLLALRYCKDRRALTVGVTNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQF
ISLVMFGLMMSEDRISLQNRRREIIHGLRSLPXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXKIKEITYMHSEGILAGELKHGPLALIDKQMPVIMVIMKDPCFAKC
QNALQQVTARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFHLAV
LRGYDVDFPRNLAKSVTVE
Download sequence
Identical sequences ENSTTRP00000013900 ENSTTRP00000013900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]