SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013995 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013995
Domain Number 1 Region: 529-632
Classification Level Classification E-value
Superfamily PH domain-like 3.56e-24
Family Pleckstrin-homology domain (PH domain) 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013995   Gene: ENSTTRG00000014760   Transcript: ENSTTRT00000014759
Sequence length 637
Comment pep:novel genescaffold:turTru1:GeneScaffold_1140:54376:74446:-1 gene:ENSTTRG00000014760 transcript:ENSTTRT00000014759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METRSSPDEGTPPPAVPECDAEVQPRELPEDSREQEVPEAPAELPSGQGAEQQTEEEEEA
GEGSSTESSRDAVEASPSVQIPATPPAASQAGEGVRGAARRLRAQQLEALTRVALLEQRV
RELQRQRKELRIQMEVEVALLRGELAGERVAVWRKEEQLWELLGQQVDSEKGVQEQREQE
QRHLSQERDRMEGLRQRLREAQGQLDLQPEDQRERLLQGVQEMKEQLDVAQRAYEDLEFQ
QLERESQWEEDWDSPRARALDPKVQELQASVVQHRGALQRRIQVLEQLKSLGEQMAAESR
GLSQRREALQALTQERSRLLKLNCLQGTPGEDFSEPSQALTKLLFTQKTNRQLLVLQDPT
AHAAAATSSCLFSVHSSLQGSIGLQGTGSLPRKRGERVSQRGSPRPLSFYCTGALKASAL
PPSARDSGRHPLYQLLNCGPRNSCGALHLDIARMEHLLQQAVAERERLLQAREGTRRSTE
GASDPPVPAIMAPPTAPSRPPGPRVLDLRQHLERWGHNPESCPHIRVSGGYCRGPLVKMG
GRIKTWRKRWFCFDRQARRLAYYTDKEQTKLKGVIYFQAIEEVYYDHLRCAFKSPNPRLT
FCVKTYERLFYMAAPSPEAMRIWMDVIVTAADENHDP
Download sequence
Identical sequences ENSTTRP00000013995 ENSTTRP00000013995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]