SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014317 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014317
Domain Number 1 Region: 94-210
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000165
Family Voltage-gated potassium channels 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014317   Gene: ENSTTRG00000015102   Transcript: ENSTTRT00000015102
Sequence length 257
Comment pep:novel genescaffold:turTru1:GeneScaffold_3286:211418:234784:-1 gene:ENSTTRG00000015102 transcript:ENSTTRT00000015102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATWDEKAVTRRAKVAPADRMSKFLKHFTVVGDDCHAWNINYKKWENEEEEEEEPPPTPA
SGAEGRDADPTAAPAPVPRPRLDFRTTLRKLFSAHRFQVIIICLVVLDALLVLAELVLDL
KIIQPDKNNYAARVFHYMSIAILTFFMMEIFFKIFVFRLEFFHHKFEILDAIVVVVSFIL
DVVLLFREHEFEALGLLILLRLWRVARIINGIIISVKTRSERQLLRLKQINIQLATKIQH
LEFSCSEKEQEIERNKL
Download sequence
Identical sequences ENSTTRP00000014317 ENSTTRP00000014317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]