SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014995 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014995
Domain Number 1 Region: 125-351
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.93e-44
Family Voltage-gated potassium channels 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014995   Gene: ENSTTRG00000015817   Transcript: ENSTTRT00000015822
Sequence length 891
Comment pep:novel genescaffold:turTru1:GeneScaffold_3153:77337:655781:1 gene:ENSTTRG00000015817 transcript:ENSTTRT00000015822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRQHAGGEEGGAAGLWVRSGAAAAAAAGWGRAGSGMKDVESGRARALLNSAAAGGDGLL
LLGTRAAALGGGGGLRESRRGKQGARMSLLGKPLSYSSGQSCRRNVKYRRLQNYLYNVLE
RPRGWAFVYHAFVFLLVFGCLILSVFSTIPEHTKLASSCLLILEFVMIVVFGLEFIIRIW
SAGCCCRYRGWQGRLRFARKPFCVIDTIVLIASIAVVSAKTQGNIFATSALRSLRFLQIL
RMVRMDRRGGTWKLLGSVVYAHSKELITAWYIGFLVLIFSSFLVYLVEKDANKEFSTYAD
ALWWGTITLTTIGYGDKTPLTWLGRLLSAGFALLGISFFALPAGILGSGFALKVQEQHRQ
KHFEKRRNPAASLIQCVWRSYAADEKSVSIATWKPHLKALHTCSPTKKEQGEASSSKVCS
HKQKLFRIHTSWKQSQKLSFKERVRMASPRGQSVKSRQASLGDRRSPSTDITTEGSPTKV
QKSWSFNDRTRFRPSLRLKSSQPKPVADADTALGTDDVYDDKGCQCDVSVEDLTPPLKTV
IRAIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVDQILGKGQIT
SDKKSREKITAEHETTDDLSMLGRVVKVEKQVQSIEAKLECLLDIYQQALRKGSASALAL
APLQTPPFDCQQTSDYQSGPAGRLPRSASAGLARGLQLILTPGELGAQTLYALSPPAAHG
PGSPGDGPAASGVGAARPAAPANLQIPTPLHALGALAPSPAGQHEGLPDVSACLEAAKEH
ALARDDLHGATLLSVRPAADQERGKSTSVQKLIGTTEDLNVPLSGSESSDSRDTQDYTDG
ESKETGSDALHAGPPSREPALASDCLRTGRSRSSRSAGATEALGRAHARLK
Download sequence
Identical sequences ENSTTRP00000014995 ENSTTRP00000014995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]