SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014996 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014996
Domain Number 1 Region: 13-337,453-500
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.64e-63
Family FAD-linked reductases, N-terminal domain 0.0053
Further Details:      
 
Domain Number 2 Region: 317-440
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 5.3e-29
Family L-aminoacid/polyamine oxidase 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014996   Gene: ENSTTRG00000015827   Transcript: ENSTTRT00000015823
Sequence length 513
Comment pep:novel genescaffold:turTru1:GeneScaffold_2456:30885:38836:1 gene:ENSTTRG00000015827 transcript:ENSTTRT00000015823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSSDRQAEAPGRGPRVLVVGGGIAGLGAAQRLCCHPAFPHLRVLEATARAGGRIRSERS
FGGVVEVGAHWIHGPSQGNPVFQLAAKYGLLGEKALSEENQLIETGGHVGLPSVSYASSG
GSVSPELVAEMARLFYSLIDQTREFLHAAETPAPSVGEYLKKEIRQHMAGWTEEEETKRL
KLAILNNLFNVECCVSGTHSMDLVALAPFGEYTVLPGLDCTFPGGYQGLTDRIMASLPKD
VMVFNKPVKTIHWDGCFEEASAPGETFPVLVECEDGGCFPAHHVVVTVPLGFLKERLDTF
FEPPLPTEKAEAIRKIGFGTNNKIFLEFEEPFWQPDCQHIQVVWRDTSPLEDAAPKLQDA
WFKKLVGFWVLPSFGASQVLCGFIAGLESEFMETLSDEDVLLSLTQVLRRVTGNPRLPAP
RSVLRSRWHSAPYTRGSYSYVAVGSSGDDLDLLAQPLPADGRGAQLQVLFAGEATHRTFY
STTHGALLSGWREADRLIALWDSQAQRPEPGSE
Download sequence
Identical sequences ENSTTRP00000014996 ENSTTRP00000014996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]