SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015177 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015177
Domain Number 1 Region: 1-60
Classification Level Classification E-value
Superfamily PriA/YqbF domain 1.01e-21
Family PSF2 N-terminal domain-like 0.0000599
Further Details:      
 
Domain Number 2 Region: 62-172
Classification Level Classification E-value
Superfamily GINS helical bundle-like 8.37e-20
Family PSF2 C-terminal domain-like 0.0000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015177   Gene: ENSTTRG00000016014   Transcript: ENSTTRT00000016014
Sequence length 185
Comment pep:novel genescaffold:turTru1:GeneScaffold_1256:61833:71205:-1 gene:ENSTTRG00000016014 transcript:ENSTTRT00000016014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVQVPLWLAINLKQRQKCRL
LPPEWMDVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXASDNIPKADEIRTLIKDV
WDTRIAKLRVSADSFVRQQEAHAKLDNLTLMEINTSGAFLTQALNHMYKLRTNLQPSDSS
QSQDL
Download sequence
Identical sequences ENSTTRP00000015177 ENSTTRP00000015177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]