SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015371 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015371
Domain Number 1 Region: 299-581
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.78e-91
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000817
Further Details:      
 
Domain Number 2 Region: 123-296
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 9.94e-50
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.00012
Further Details:      
 
Domain Number 3 Region: 583-691
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 2.57e-26
Family Anticodon-binding domain of Class II aaRS 0.0013
Further Details:      
 
Domain Number 4 Region: 61-121
Classification Level Classification E-value
Superfamily TGS-like 0.00000000014
Family TGS domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015371   Gene: ENSTTRG00000016207   Transcript: ENSTTRT00000016214
Sequence length 700
Comment pep:novel genescaffold:turTru1:GeneScaffold_3099:34426:87497:-1 gene:ENSTTRG00000016207 transcript:ENSTTRT00000016214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPPSQSQGKDIKKKKESGPDSEVKNPPNFVKERLKLFEILKKDHQLLLAIYGKKGNTSNV
ITVRVADGKTVEGEAWKTTPYQVAAEISQELAESTVIAKVNGELWDLDRPLEDTTLELLT
FEDKEAQTVYWHSSAHVLGEALELHYGGLLCCGPPTDCGFYYDMFLKDRAVSSTELPALE
STCKAIIKEQQPFERLEVSKEALLDLFKYNKFKCRILKENINTPTTTVYRCGPLVDLCKG
PHVRHTGKIKEIKIFKNSSAYWEGNPEMETLQRVYGISFPDDQMMTAWEKLQEETKTQDH
RRIGKEQELFFFHDLSPGSCFFLPRGAFVYNTLMDFIREEYHQRSFMEVLSPNVYSSKLW
ETSGHWQHYSDNMFTFDIDKDTFALKPMNCPGHCLMFAHRPRSWREMPIRFADFGALHRN
EPSGTLHGLTHVRRFQQDDAHIFCTVEQIEEEIKGCLQFLQSVYSTFGFSFQLNLSTRPE
NFLGEVEIWDEAEKQLQNSLMEFGKPWKMNPGDGAFYGPKIDIKIKDAIGRYHQCATIQL
DFQLPVRFNLTYVSKDGDDKKNPVIIHRAILGSVERMIAILSENYGGKWPFWLSPRQVMV
IPVEPTCEKYALQVSTEFFEEGFMADVDLDHSCTLNKKIQNAQLDQYNFILVVGEKEKTN
NAVNVRTRDNKIHGEISVTSAIDKLKNLKKSRTLNAEEEF
Download sequence
Identical sequences ENSTTRP00000015371 ENSTTRP00000015371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]