SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015500 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015500
Domain Number 1 Region: 1132-1230
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-24
Family Pleckstrin-homology domain (PH domain) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015500   Gene: ENSTTRG00000016355   Transcript: ENSTTRT00000016355
Sequence length 1241
Comment pep:novel genescaffold:turTru1:GeneScaffold_1750:30489:131102:1 gene:ENSTTRG00000016355 transcript:ENSTTRT00000016355 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEQSHMQKQLDLQNGSLEAGFVANSLENDSQNMMESLSPKKYSSSLRFKTNGDYSGSYL
TLSQPVPAKRSPSPLGTSVRSSPSLAKIQGTKQFSCDGNDKNISVKPPTPLRSTSPSLSG
YPLGRTDFDHFTGRDTERSLRLSEKPPYSKYSSRNKSHDNVYFLGGLEGRKASGSLLTMW
NGSSLGDTGSLPIGRSGAASMPSSPKQARKISIQDNLTLQPKVTRHKDLASENISLRTRK
YSGSSLSHMGAYSRSLPRLHRATENQLAPLSLPPRSSLGNYKRTKLGEKDLPHSITDNDN
YLNFSSLSSGALPYKTSASEGNPYVSSTLSVPASPRVARKMLLASTSSCTSDDLDRASYL
GTSPGHSFPPGELDRAFAARRNYSCGSVEFDDADPDSLRQASGTPQPVLRERKSSISSIS
GRDDLMDYHRRQREERLREQEMERLERQRLETILSLCAEYTKPDSHVSTGTTVADVQKIN
KELEKLQLSDEESVFEDALVSPDTRYRCHQKSSLHDADLAGFGSLSQSSASFLSLRSSRN
DELIRDLTRTPPPPSSAFLKASSESAYLSILPKTPEGISEEQRIQELTAMEESRIAILNN
LEELEQKIKDINDQMEESSRELDMECALLDGEQKSETTELMKEKEILDHLNRKIAELEKN
IVGEKTKEKVKLDAEREKLERLQELYSEQKTQLDNCPESMREQLQQQLKRDADLLDVESH
FEDLFQQLELTQQLLREVAEYQRNIVTRKEKISALKKQANHIVQQAQREQDHFVKEKNNL
IMMLQREKENLCNLEKKYSSLSGGKGFPVNPNTLKEGYIIVNEINEPCGNSTNLSPSTQF
PADADAVATGPTTAVLASQPQNKEHFRSLEERKKQHQEGLYLSDTLPRKKTTPSISPHFS
SATMGRSTAPKGHLPLGQSNSCGSVLPHSLATMTKDSESRRMLRGYNHQQMSEGQRQKSS
EFYSRTASESNVYLNSFHYPDHSYKDQAFDTLSLDSSDSMETSISACSPDNISSASTSNI
ARIEEMERLLKQAHAEKTRLLESREREMEAKKRALEEEKRRRELLEKRLQEETSQRQKLI
EKEVKIREKQRAQARPLTRYLPIRKEDFDLRSHVETAGHNIDTCYHVSITEKTCRGFLIK
MGGKIKTWKKRWFVFDRNKRTFSYYADKHEAKLKGVIYFQAIEEVYYDHLKNANKSPNPL
LTFSVKTHDRIYYMVAPSPEAMRIWMDVIVTGAEGYTHFLL
Download sequence
Identical sequences ENSTTRP00000015500 ENSTTRP00000015500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]