SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000016160 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000016160
Domain Number 1 Region: 92-190
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000000000223
Family cAMP-binding domain 0.014
Further Details:      
 
Domain Number 2 Region: 231-294,408-461
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000000249
Family cAMP-binding domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000016160   Gene: ENSTTRG00000017045   Transcript: ENSTTRT00000017046
Sequence length 574
Comment pep:novel genescaffold:turTru1:GeneScaffold_3593:704240:748421:1 gene:ENSTTRG00000017045 transcript:ENSTTRT00000017046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRYMVSHSWQILKKELGLYQLTMDIIRMNRVCRMFRQGLRGLREYQIIETAHRKHPIFS
FWDKKKQGRITFDTMDFIGESEHFPPRAIQITQKKPAWRTEREIQSLCNLLQVLDSYQNY
SEPLQLLLAKVMRFERFGRRRVIIRKGQRANSFYFIYLGTVAVTEDEDGSSAFLDPHPTL
LQKGSSFGXXXXXXXXXXXXXXXXXXXXXXXXVDREDFLANKLDQEVKKDAQHREFFRKM
DLFHSWSDEKLWKLVMLGKIEKFSYGQLISKDFVESSSIVFVCKGSCEVLQLIDLATSPF
YHKWVWQHLQLIDDRPPNTHLKDLSPVERFKEFQIKSYPVQDFSSLKLLHLRKAQEQQGS
SFSRKIKTSANTLPKTLGPKIKSRCPHFIECPMIDTKYGALPKEAAVGAYVKIHTVEQGE
VLGLHQILLPESQRDTRPLILVSLGAEVIRVRKEKFCELIDSKTIEKLSKFEIKYPSDED
VCQKFLEENSWNVFRKDLMRLLVEPRQCPPFTPIQPKKKGIYKPKAVMLDLCSLDKKTRP
RHPIFMAPQKYLPPLRIVETIIAPRYKIQELLPQ
Download sequence
Identical sequences ENSTTRP00000016160 ENSTTRP00000016160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]