SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000016328 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000016328
Domain Number 1 Region: 464-521
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.92e-26
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 520-577
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.57e-24
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 3 Region: 688-745
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.59e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 408-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.43e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 5 Region: 576-631
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-22
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 6 Region: 634-689
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.63e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 7 Region: 56-103
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.35e-21
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 8 Region: 730-782
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.68e-17
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 9 Region: 355-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000781
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 10 Region: 284-335
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000129
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000016328   Gene: ENSTTRG00000017225   Transcript: ENSTTRT00000017225
Sequence length 792
Comment pep:novel genescaffold:turTru1:GeneScaffold_2488:910:19376:-1 gene:ENSTTRG00000017225 transcript:ENSTTRT00000017225 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAINPWASWGIFTDQSWGMAAVDPWASWALCPQDSTWCVEKTPEERRRAPRLPTAQAQE
PVTFKDVAVDFTQEEWGQLDPVQRTLYRDVMLETYGHLLSVXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXWVRNLESKALIPTQSILEEEQSHSMKLERYIWDDPWFSRLEVLGCK
DQLEMYHMNQSTAMRQMVFMQKQVLSQRGAEFCELGAGCSQRLSIVPSQKVSQIEHFYKP
DTNAESWRCNSAIMYADKITCENNEYDKAFYHSMQPVHPARVQTGDNLFKCTDAVKSFNH
ILHFGDHMGMHTGEKLYEYKECHQIFNQSPSFSEHPGLHIGGNQYDYKEYENIFYFSSFM
EHQKIGTVEKAYKYNEWEKVFGYDSFLTQHTSTYTAEKPYEYNECGTSFIWSSYLIQHKK
THTGEKPYECDKCGKVFRNRSALTKHERTHTGIKPYECNKCGKAFSWNSHLIVHKRIHTG
EKPYVCNECGKSFNWNSHLIGHQRTHTGEKPFECTECGKSFSWSSHLIAHMRMHTGEKPF
KCDECEKAFRDYSALSKHERTHSGAKPYKCTECGKSFSWSSHLIAHQRTHTGEKPYNCQE
CGKAFRERSALTKHEIIHSGIKPYECNKCGKSCSQMAHLVRHQRTHTGEKPYECNKCGKS
FSQSCHLVAHRRIHTGEKPYKCNQCERSFNCSSHLIAHRRTHTGEKPYRCNECGKAFNES
SSLIVHLRNHTGEKPYKCNHCEKAFCKNSSLIIHQRMHSGEKRFICTDCGKAFSGHSALL
QHQRNHSEEKLN
Download sequence
Identical sequences ENSTTRP00000016328 ENSTTRP00000016328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]