SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|442556086|ref|YP_007365911.1| from Lawsonia intracellularis N343

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|442556086|ref|YP_007365911.1|
Domain Number 1 Region: 316-449
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 4.04e-30
Family HD domain 0.017
Further Details:      
 
Domain Number 2 Region: 208-291
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000835
Family Eukaryotic type KH-domain (KH-domain type I) 0.0033
Further Details:      
 
Weak hits

Sequence:  gi|442556086|ref|YP_007365911.1|
Domain Number - Region: 28-71
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit B, membrane domain 0.000327
Family F1F0 ATP synthase subunit B, membrane domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|442556086|ref|YP_007365911.1|
Sequence length 520
Comment phosphodiesterase [Lawsonia intracellularis N343]
Sequence
MSFILVLCTVSSLFVGGGTGIFLYKKVSKKYIGDAKELAIRIVEEARKEGQAQKKEILLQ
GQNEIFNQKKEFEFDFKQREKELSIKDKKLQVQSERLEERLERAAEKEHEILKVEKELSI
KERNLLTLEEQLKSRIDEQEKQLQKISGLTVEEAKQSLFEEVKNRSRHESAKMMRLIEAE
AVETANRKAKEIIANAIQRYAGDYVSEHTVTAVTLPSEDMKGRIIGREGRNIRALESATG
VDFIIDDTPETVVLSAYSPMRRQVAKMALERLIQDGRIHPARIEEIVRKCEEDLAIQVRE
IGEQATFDIGVYGIHPELIRILGQLNYRTSYTQNVLRHSIEVASLCGMMAAELGVDIKKA
KRAGLLHDIGKAVDHEVEGSHAIIGAELAKKFNETEEIVHAIEAHHEEKGKPETALAILV
QASDCLSGARPGARLELLESYVKRLEHLENIAGEFEGVSKAYAIQAGREVRVMVDADSIG
DDQTYLLCKDIAGRIEESLTYPGQIRVTVIREHRAVGYAK
Download sequence
Identical sequences A0A1S8BT11 Q1MQ71
gi|442556086|ref|YP_007365911.1| WP_011526885.1.40060 WP_011526885.1.91582 WP_011526885.1.98040 363253.LI0802 gi|94987244|ref|YP_595177.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]