SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|345012687|ref|YP_004815041.1| from Streptomyces violaceusniger Tu 4113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|345012687|ref|YP_004815041.1|
Domain Number 1 Region: 17-406
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 7.59e-69
Family Gtf glycosyltransferase 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|345012687|ref|YP_004815041.1|
Sequence length 421
Comment MGT family glycosyltransferase [Streptomyces violaceusniger Tu 4113]
Sequence
MSDPSRSQAAPPRIPRRFLFVVPPLVGHVNPTLGVAAELTARGHQVAWAGMPEVVGRLTG
QGATVYRCAGPVLGEGGAGRPPDVRGPAALRFLWERFLVPLAEAMAPGVAKAIEEFRPDV
VIADQQTVAGGLVAERLGVRWATSATTSAEFTGALDGLPKIDAWLDGQMDEVRGRIGDPE
STADPRFSPDLVLAFTTEELAGRPARAGDRIRYVGPSIAERPATTDFPWEWLDPARLAVL
VTLGTANTDAGARFLTECREAVRARAGRFQTVIVDPEGVLTPGTPDTPDDKNVLVRRYIP
QLPLLERVSAVVCHAGHNTVCETLWHGVPLVVAPIRDDQPVVAAQVVDAGAGVRVRFGRA
RAAGLGEALDTVLYEPGYRIAAEHVGASFRAAGGAVAAAGHLEALAAKTDGHATPTPEGD
R
Download sequence
Identical sequences G2P5E8
gi|345012687|ref|YP_004815041.1| WP_014058247.1.85068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]