SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|345013482|ref|YP_004815836.1| from Streptomyces violaceusniger Tu 4113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|345013482|ref|YP_004815836.1|
Domain Number 1 Region: 20-105
Classification Level Classification E-value
Superfamily Homeodomain-like 3.19e-20
Family Tetracyclin repressor-like, N-terminal domain 0.009
Further Details:      
 
Domain Number 2 Region: 99-201
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.000000000000116
Family Tetracyclin repressor-like, C-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|345013482|ref|YP_004815836.1|
Sequence length 224
Comment TetR family transcriptional regulator [Streptomyces violaceusniger Tu 4113]
Sequence
MTSADQSTPTQPPATQPPAKRARRADAERNRAAIIEAAGVVFAERGGTVDVREIARRSGV
GMGTLYRHFPTKDDLLATVLEREFTCWLTAAHEAAEATEDPWEALTGFFEQTLTHQARNR
AMVESYAATGAPSRACAQYRDAFIDELRTRCLNAGLLRAGVTTADLVLLSASLSQIVQAT
GDSHPGQWRRLLRISLDGLRARNAEPLPEPESDPAPHGDAPAND
Download sequence
Identical sequences G2PGH7
WP_014059041.1.85068 gi|345013482|ref|YP_004815836.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]