SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|345015319|ref|YP_004817673.1| from Streptomyces violaceusniger Tu 4113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|345015319|ref|YP_004817673.1|
Domain Number 1 Region: 12-402
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 5.5e-79
Family Gtf glycosyltransferase 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|345015319|ref|YP_004817673.1|
Sequence length 406
Comment MGT family glycosyltransferase [Streptomyces violaceusniger Tu 4113]
Sequence
MTPSTGAKPPTHIAMFGIAAHGHVNPSLEVIRELVARGHRVTYAIPESFAEKVAETGAEP
KTYTSVLHGENVPGATGSELIDYIEPFLAEAEQALPQHLAAYEGDEPDLVMYDVTAYPAH
VLAHRWGVSAVELAPSFVPWDGYREEVFEPMYAQLRCSERGRAYYARYRAWLEDNGLAGT
DPDRLIGRPSRCVALIPELLQPNADRVDPSVYSFVGGCQSARREVAEWRRPERAAQTDRI
LLVSLGSTWTKEPGFYRACVAAFGDLPGWYVVLQIGEFVDRADLGEIPANAEVHSWIPQL
SILRKADAFVTHAGAGGAQEGLACGVPMVAVPQAVDQFSNADTLEALGVGRHLPKEEATA
SALRKAVLDLVDDPEVAARCAALKARMAAEGGPDRAADLIEAELPV
Download sequence
Identical sequences G2P7T1
WP_014060859.1.85068 gi|345015319|ref|YP_004817673.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]