SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|345009729|ref|YP_004812083.1| from Streptomyces violaceusniger Tu 4113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|345009729|ref|YP_004812083.1|
Domain Number 1 Region: 6-151
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.57e-46
Family Ribonuclease PH domain 1-like 0.0000000995
Further Details:      
 
Domain Number 2 Region: 322-492
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.9e-42
Family Ribonuclease PH domain 1-like 0.000000351
Further Details:      
 
Domain Number 3 Region: 152-260
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.13e-28
Family Ribonuclease PH domain 2-like 0.00000143
Further Details:      
 
Domain Number 4 Region: 474-573
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.8e-24
Family Ribonuclease PH domain 2-like 0.00000834
Further Details:      
 
Domain Number 5 Region: 576-688
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.94e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0037
Further Details:      
 
Domain Number 6 Region: 264-344
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 7.59e-17
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|345009729|ref|YP_004812083.1|
Sequence length 752
Comment polyribonucleotide nucleotidyltransferase [Streptomyces violaceusniger Tu 4113]
Sequence
MENETHYAEAVIDNGTFGTRTIRFETGRLARQAAGSAVAYLDDDTMVLSATTVSKNPKDQ
LDFFPLTVDVEERMYAAGRIPGSFFRREGRPSEDAILTCRLIDRPLRPSFKKGLRNEIQV
VETIMALNPDHLYDVVAINAASCSTQLAGLPFSGPIGGTRVALIKGQWVAFPTHSELEEA
VFDMVVAGRVLEDGDVAIMMVEAEATQQTIQLVKDGAEAPTEEIVAAGLEASKPFIKVLC
KAQADLAAKAAKPTAEFPIFLDFQDDILEALTAAVRDELAQALTIAGKQEREAELDRVKG
LAAEKLLPQFEGREKEISAAYRALTKTLVRERVIKEKKRIDGRGVTDIRTLAAEVEAIPR
VHGSALFERGETQILGVTTLNMLRMEQQLDTLAPETRKRYMHNYNFPPYSTGETGRVGSP
KRREIGHGALAERALLPVLPTREEFPYAIRQVSEALSSNGSTSMGSVCASTMSLLNAGVP
LKAPVAGIAMGLISQEIDGETHYVTLTDILGAEDAFGDMDFKVAGTKQFVTALQLDTKLD
GIPASVLAAALKQARDARLHILDVMNEAIDVPDEMSPNAPRIITVKIPVDKIGEVIGPKG
KMINQIQEDTGADITIEDDGTIYIGAVDGPAAEAARATINGIANPTMPEVGERYLGTVVK
TTTFGAFVSLLPGKDGLLHISQIRKLAGGKRVENVEDVLKVGAKVQVEIAEIDQRGKLSL
IPVLEDGEGGSDADADEASDEAQPQSKDEAAK
Download sequence
Identical sequences G2NTF5
gi|345009729|ref|YP_004812083.1| WP_014055309.1.85068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]