SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gb|CMU_018990 from Cryptosporidium muris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gb|CMU_018990
Domain Number 1 Region: 67-139
Classification Level Classification E-value
Superfamily WWE domain 0.000000000000017
Family WWE domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gb|CMU_018990
Sequence length 1178
Comment | organism=Cryptosporidium_muris | product=WWE domain-containing protein | location=scf_24:785529-789065(-) | length=1178
Sequence
MSTSVLQSEFITKYPYLNYSNNSEADNPNKEVNSNSLLSNSSSTYIPLSDSPCIVNSSPK
SPVCISPTKSYSSSTGNWMYQCNKGWRFYPTIDNLEIEKSYQDGSPSIELYPYRIDFLRF
IQVNMNTGKVRSIIRDGIKPKNICTIKGKDDFDEIKTRIYQLNSNNKVGYLTNTLNNEDS
FSSLLVEPIFSSIANGTFDFLNNIMKSINFGNSTDSESDCIEDGDSTNNTEYDGSGSVYL
SANSLTGISNYQIPIKYKDKISINSPNRINTSTPLILTPCNSPNTGSAIVTPTNTNNQLF
GKPICSYTTKNNYIPCTPRHKQNLLIQSPCNSIFPSKYSSVVPLNGQDVTTNRSPVRISP
LMNLSPISNDFTKALFSSVNLSPSPSIQSPDKIEDYSKLKYMSPPKLFSNTQISKSKLDY
SKSFLGGNLEVDNKPENFEILNSFQPYKYRRTVGIVSSKSFLTKSCSTNDKKLVRFNKLS
PIVKESCDKFMNLGDVISLPNETDMYSIKEQCDKPEVQFSNEDKSIPGLDITDIEDLFSP
KLPEINKDSDFPEYDDKYSNVEGINHYNDLYDHPTSDDDFSSGLSLNFPLSHISYMDEDL
LSMDYELNKKKSISKYLGSIQPNIFNENYHSFSPSNNLGTTDPNLSRVIDLRNINPSNGV
PYEIIWWSNHSIKSLFVQLDCDIGYSLPFQAPIELLPLLHPLLKGYMDTPSNLSQIKNET
NEPCSVLMGLKNLEIKFLKPSIGEYSKISDFCYKELKNVTPTILDQFEISQSVLPISIFS
LLLTRFPVPAANTFLFSFICNDDSYPHSGMQTIQILSFQLQKKTCMNSKYLTNSWNKDKV
GNLNDSSCSHIHLDSHRSNSLKVCPWLAISNIIDEFILRTPIVVKCVLDHCNIMIIPSNV
YCNYKSTKNNEFKEYDFVILTLNLLIPLLIIHSQCLQNIVIGDNKPFSKDNSDLFININT
KIRIDAMILSCRYLPCTFPSIRNIDLVLDLNLDNTNIGSTLLSKKNILYSNSLSITSDEE
IPTNQKDNLHNNNLPENDISIFEPYHENFISELNNLVREWMNEFIEWFDKYVGDSIEYIE
ITLYLSLRCIEGNIQDYFILQNRNLHETNVKIDLLMGNSDDISTHFEQISQDFANNIKEC
RNNIKNSNLSILISPILANLLLDITISNSFSRLSTPKS
Download sequence
Identical sequences B6AC86
gb|CMU_018990 XP_002140491.1.43237 gi|209556097|gb|EEA06142.1| gi|209878099|ref|XP_002140491.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]