SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gb|CMU_021640 from Cryptosporidium muris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gb|CMU_021640
Domain Number 1 Region: 1-66
Classification Level Classification E-value
Superfamily WWE domain 0.0000000000000484
Family WWE domain 0.0046
Further Details:      
 
Domain Number 2 Region: 290-364
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000883
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Weak hits

Sequence:  gb|CMU_021640
Domain Number - Region: 68-95
Classification Level Classification E-value
Superfamily WWE domain 0.0255
Family WWE domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gb|CMU_021640
Sequence length 504
Comment | organism=Cryptosporidium_muris | product=zinc finger, C3HC4 type domain-containing protein | location=scf_27:141159-142673(-) | length=504
Sequence
MWRWWSDEGWTYYSLENSAIIERSWRNKEINIIINIGGIPFLLNLRHFYQFNFITQRHRR
ISRDISSAVWFWTDNNGQLNLYQPNVSAQIERYYLHIQWNLVKSSNIHKNNKKNQSITSD
DTYTFDSADKLKINNSSIVNSNSSNEYLELVSAESVSKENVREERTNMTRDCSTIQNHHI
QGGGCIVWGHYDIYPIECIQINRITGKERRIFRKHLKNISEDNENQLDQNGIKRITSEPG
CYLEWQFTDTKIARISDAISLIVETGEFYCVGYPTLFSNEKIMDLVYQLPDDTLIDDDCC
LCLHPLIENRIKLKKCHHVYHKDCFFEMVRHLKQKNVLNCPLCMSIQDYGKGASPYGRMR
YIVYKAGNIEIETYPSTNVIEIEYFIPSGIQNERHPNPSKPFSGTYKIAYLPYDKDGIMV
LNGLIKAFKLGHTFKVISIPNISENVNSRHHNDHICTEIVQWNSIPHKISTCGGPTLQGF
PDPYYFNLVIEKLASVGIDCNAEM
Download sequence
Identical sequences B6AJK9
gb|CMU_021640 XP_002142749.1.43237 gi|209558355|gb|EEA08400.1| gi|209882626|ref|XP_002142749.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]