SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gb|CMU_028700 from Cryptosporidium muris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gb|CMU_028700
Domain Number 1 Region: 366-411
Classification Level Classification E-value
Superfamily RING/U-box 8.35e-18
Family RING finger domain, C3HC4 0.0082
Further Details:      
 
Domain Number 2 Region: 201-277
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 4.58e-17
Family Cdc48 domain 2-like 0.0007
Further Details:      
 
Weak hits

Sequence:  gb|CMU_028700
Domain Number - Region: 143-196
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 0.00719
Family Cdc48 domain 2-like 0.0066
Further Details:      
 
Domain Number - Region: 8-82
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 0.0252
Family Cdc48 domain 2-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gb|CMU_028700
Sequence length 413
Comment | organism=Cryptosporidium_muris | product=zinc finger, C3HC4 type domain-containing protein | location=scf_36:64253-65494(-) | length=413
Sequence
MYESTENPRYLAKIQLLPWAEQLDVDSLLRSMREYEVTKRVIRPYNRIYINKTKYYVVLF
CDPEEGGILTEHTQVYTNGKPIVPLKKVHFLALPPFNASTSPLAQRVTTIRLNRGIQEEA
NTVPETCDISIDDINTLCDRDTLCKLYVEPYFKKCRKEPVYVGRRINMEGIVFLVWACDP
CQIGVINKNTAVYIDWDCFGEFKRIHVMPFSDTLPQTYSYDIFQDYLKPFLSRYTFHPFC
QGESFTYNGVQFKVVATDPVGVKARIGDNTTIFCQGSLTPSIVDLLPIHLLENITRLPPR
SRPFAILQALTHLPPSDVDRIFGMADANNNRGVNNDVILTISQKAFIYHSQLQVGSNSEP
SDEPPMCTVCLSEVNNGENVVKLNCQHLFHLQCIQEWLRMSVICPLCKVDVRS
Download sequence
Identical sequences B6AHV5
XP_002142145.1.43237 gb|CMU_028700 gi|209557751|gb|EEA07796.1| gi|209881414|ref|XP_002142145.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]