SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|532459027|ref|YP_008458679.1| from Amycolatopsis mediterranei RB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|532459027|ref|YP_008458679.1|
Domain Number 1 Region: 38-313
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 1.71e-49
Family alpha-L-arabinanase-like 0.004
Further Details:      
 
Domain Number 2 Region: 333-465
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.91e-45
Family Ricin B-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|532459027|ref|YP_008458679.1|
Sequence length 470
Comment beta-xylosidase [Amycolatopsis mediterranei RB]
Sequence
MSLLVLVTLLLAAPGAQAAPVTVTNGSQFTDPAGALVHAHGGGMLKVGAYYYWFGENRNA
DDTFRAVSVYRSTDLKTWEFRNDVLTQSSAAELGRVKIERPKVVYNSSTGQYVMWMHKEN
GDDYAEARAAVATSSTVDGGYTYRGSFRPLGVHMSRDITLFKDDDGTAYMASAARENADL
NVYRLTADYTGVAALVQTLWPGSYREAPAMFKRNGVYFLLTSAATGWQPNQQKYATATSV
TGTWSGLTNVGDSTGFGSQTAYVLPVAGSQATSYLYLGDRWAGAWSRPVNESRYVWLPLG
FPGATTMSLSWSPKVSIDAATGVVAGVGTGSAYESLVARHSGKCADVPGSAKDDGTAVKQ
YSCNGGWNQHWSVLDLGNGYASLIARHSGKCLDVSDASTADGAAAIQWACNGGTNQQWQL
QAADGGYVRIVARHSGKCLDVVSASTADGAALKQYPCTGVTNQQWLRRAA
Download sequence
Identical sequences A0A0H3CZT3 G0G6A0
gi|300784280|ref|YP_003764571.1| WP_013224246.1.26188 WP_013224246.1.53613 WP_013224246.1.63706 WP_013224246.1.79787 WP_013224246.1.88400 WP_013224246.1.99940 YP_003764571.1.66228 gi|399536165|ref|YP_006548827.1| gi|532459027|ref|YP_008458679.1| gi|399536165|ref|YP_006548827.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]