SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|532463178|ref|YP_008462830.1| from Amycolatopsis mediterranei RB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|532463178|ref|YP_008462830.1|
Domain Number 1 Region: 3-364
Classification Level Classification E-value
Superfamily Serpins 1.96e-87
Family Serpins 0.000000432
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|532463178|ref|YP_008462830.1|
Sequence length 364
Comment serine protease inhibitor serpin-like protein [Amycolatopsis mediterranei RB]
Sequence
MATDSHLRFALAVHSALGAGGGNTCFSPYSVASALTLAARAARGQTRDELVALLGDPGEQ
TVLLREAARLVEEAHSKDQPELAVANTLWADDRLPLEDSFKAELAEWPGAAVASAPFEKE
PEAARALINEDIGRTTRGLIPQLLPLGSIDSQVAAVLVNALYLKAAWKLPFREANTSDAP
FHAPSGTRDVPTMWLSESVGYAHTGGWQAVRLVAAGGLQAVVLLPDDDLAEAETRLDHAA
LTSLLGKIRAKKVELSLPKVSLDVSSKLAGVLRGLGVRTMFTDEADLSGLTPDPRLTVSE
VLHQAVLRVDEQGFEGAAATALIMRLTSMMIDDPVAVTVDRPFLLLVRHAGTGALYFIAR
VVEP
Download sequence
Identical sequences A0A0H3DE38 G0FU17
gi|399540317|ref|YP_006552979.1| gi|399540317|ref|YP_006552979.1| gi|300788434|ref|YP_003768725.1| WP_013228372.1.26188 WP_013228372.1.53613 WP_013228372.1.63706 WP_013228372.1.79787 WP_013228372.1.88400 WP_013228372.1.99940 YP_003768725.1.66228 gi|532463178|ref|YP_008462830.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]