SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gb|TGME49_024660 from Toxoplasma gondii ME49

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gb|TGME49_024660
Domain Number 1 Region: 837-899
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 0.0000000000248
Family Elongation factor TFIIS domain 2 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gb|TGME49_024660
Sequence length 1313
Comment | organism=Toxoplasma_gondii_ME49 | product=transcription factor S-II central domain-containing protein | location=TGME49_chrX:2845724-2849665(+) | length=1313
Sequence
MVDPELMDNAESGAVDVEDLSAPSLDPPPSPSSPPSPRELARLEPSESPQTPPVCLFQLA
GETFYLHDWVRLKSSGERDWVAQIVAYFPGSDSEKSGGVEDADGGSGGRILCRWGWDPRD
LRREACPALPLQSYSRFEVIPAINFCDENPIQSIKAKVRVEKYEKWKRRAAFPPLVRCTA
DDEEDVDKDKSGQSGNAAQRDSDPGQTCMPSVLFYRHSHEIETGFHPSLVADVFRFKRIS
RSATARGGSLSADLAVAGSPSSGTKSEHGGDEIAQAIDLGSEGEGPAAKGGFSDARSGDF
AAPTYRRYPSLRNPDVRHFFCCNCRSTFAPPDDVAPPVWPDPEEVSQAEGGRYLLDAGIS
ASYHPAVLPPEGPGSAAGPHSAGEATGPSRQREEAKATPQPPQLKLLLLEEFRNSTGDRP
LSVLSPVQLPFVWMRTPAEGDFIILCWKCTGKRRKRREESAGRKPAAAATSASRDSGVVN
RRKRRAETEDEAGEGPPAGHSLRRRAGQRGEKPARENEASHALSQQTTAQKIAGDSMAFE
ETGQPKDRSEVSYGETGEKSQGEGSGSENTARSGPRQEDAEPSRKRRKAASGVARVAAAM
AAAEASSDADMDEDSDADFVAHSEEDSGGRCSAAAAEPRAKLKRSSRVAGDAEPPEAASP
SRKARKESAPANGTSSSSGPAARRKSSGTSAAAPLGSRRSSAGGGLLSGPGSGATRPGGP
SDWQAGNQARVDRLTEAFRLGIRELEEEAKQSLPGEAGADALAATKASGVFGTKGAEGAA
ASAKAEGGEVAERLMTSPGSDSGAGRGSGGSGPEGEGGTEPSKTLPDLLFATAEACAKAV
NAAFVSQHKTLDSRRQKQRFFELLSNLKRENNQELRKKVLTGQISVRRLVTLESAELAPS
FVRKEREEERERHFRQAVLLHEAPAAALARLRKTHKGIEPVIEDPDLLQTSPPARGIAPP
IITVEKTAAAAKEKRIRVRAETDLRGSSSPSQSSGSSSSDSDDSASASDSDGSESEETSG
SEDGETSAESGSESESSCELRREKLGGGANGESGHLAQARREAASGKESGGTGSGVQEQL
ASLKRLFSQATSGDFGADSCRTPAVGGERASEGGILKRGDGDAGERGEEGTENDGVQKNR
QQRERRVAFSEETHTADGPTGKGIVSKSKKRRHTLARFSSSASRSCATLPRLPELLPNPP
EEDGTERAGNGRENGRKGEAAAARAHRQSSVLGVPLDCSSLSPDACKDRVRHLLERVPLV
GMQPPPSRPGNEDGEGLQTARTTPLLDYKAVVASMFRYLNVAFDRVTLDLQRR
Download sequence
Identical sequences A0A086KMM8 A0A139XTP6 S8GEU8
gb|TGME49_024660 XP_002366140.1.89292 gi|211963804|gb|EEA98999.1| gi|237833685|ref|XP_002366140.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]