SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gb|TGME49_002400 from Toxoplasma gondii ME49

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gb|TGME49_002400
Domain Number 1 Region: 246-371
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000455
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 2 Region: 203-250
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000355
Family EGF-type module 0.039
Further Details:      
 
Domain Number 3 Region: 666-739
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000408
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 4 Region: 571-628
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000251
Family EGF-type module 0.006
Further Details:      
 
Domain Number 5 Region: 734-779
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000075
Family EGF-type module 0.0084
Further Details:      
 
Weak hits

Sequence:  gb|TGME49_002400
Domain Number - Region: 784-838
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00391
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gb|TGME49_002400
Sequence length 893
Comment | organism=Toxoplasma_gondii_ME49 | product=fibrillin-2 precursor, putative | location=TGME49_chrVIIa:3319623-3324428(+) | length=893
Sequence
MAPQHSSPSTQPYPSSYAGTVAPGSFSPVPAQPSNSLPLPLSVSSLALSPVPDPRSVAPY
SAPLPDRDPAGMPSAYQRLPSPAPSVNSPNSIMFTESPQQAPGFLSSLLPSRSSPGGFLG
LTGSGEGGPGPSIQQLGTLMADIATCDPKTEGVCCLARNYCDPNATCFSDAAPDSVFDIL
NAIPRCTCREGFEGDGRTKGTGCSNIDECATGQAGCEQICKDFAPGYACSCYDGYMLKAN
GKDCQDINECLTANGGCQHVCVNTPGTFFCDCAAGFVLGQDGRSCTDIDECALDENICEH
KCENLPGAFQCRCNSGYKRSVDDPRKCVDRNECVEGLGDGPPACAPDGSEECTNTPGSYT
CSCAKGYRRLQTQQTKQALLLEDSYEEAPRQNRRKWTGGKKEGQSEDGSASASQRMLQWA
QALDAFTSLAAASTSAHATSRQKASSGTPTDTALAIADLAMQFAHMYGSANKALNAIGGL
SPATAPATAIQINSLSPLLREGENLKNRPLLQDPGRITRKELVSYRAEEDDSQQQTWSDE
MYAVVKNLDVLRRQPWIDPPSMAETDRNGECVDIDECAEFQKAGLRACKIDELICVNTPG
SYECQCGEGLEYDEDAASCVDIDECLLAKKLHFSRNSEGQGVTPAVRIQQQRELQGGKLL
PGRPALCDQQCLNLMGKYECGCYPGFVLQPDGRCDDIDECIDPTLHGCDHICINLPGTYS
CQCRPGYRLSLEKKGACVDIDECAENPELCEFGCKNLPGAYECTCPPDSKQRADKRGCEP
NLSCKEDPSQCQGDHVCRVDGTSQKWKCSCPDGFSAAPSSRRNSNPPRCVDINECAVGYP
TPGRNPCPDLYRPCCLNVAGGFQCVMARRKGLATSRQLYCEAPSFDFQGRLNR
Download sequence
Identical sequences gb|TGME49_002400 gi|211965189|gb|EEB00385.1| gi|237836455|ref|XP_002367525.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]