SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gb|TGME49_091030 from Toxoplasma gondii ME49

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gb|TGME49_091030
Domain Number 1 Region: 875-929
Classification Level Classification E-value
Superfamily RING/U-box 3.09e-17
Family RING finger domain, C3HC4 0.0043
Further Details:      
 
Domain Number 2 Region: 558-635
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 0.00000000000128
Family Cdc48 domain 2-like 0.00051
Further Details:      
 
Weak hits

Sequence:  gb|TGME49_091030
Domain Number - Region: 519-555
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 0.00687
Family Cdc48 domain 2-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gb|TGME49_091030
Sequence length 990
Comment | organism=Toxoplasma_gondii_ME49 | product=hypothetical protein | location=TGME49_chrIX:4167512-4172332(+) | length=990
Sequence
MEGEEQPLRNRVEPDQGMSVNAGVSASANEDSTHAEGAQNSTPPSQLVKKRWLEKVHVLP
IGNKAADSEVFAALKKMMADDVLLQQYMAFEVPVTLANCPTSGASVDTGERSKVETSKEP
EPEADTLPACTYIVVECCPRSGYVGRETLVFLAGQPLQPLRRVQLLALVHPNSSYARRAG
IHSYQQLFDQAPSFPSLDRQEPSVEDSAPVYTLSSMVHSSPAASTQPVGQLLSPFTPAFF
DDRQAASDDGFPFGFTDIIEELESVSSSTSTSDEETERLGERHSHGFSLRGPTVPRPASR
GDVTEVGENESAECSEVEDSDRPASFESRRSASSSSTQATEGRRESGDGSGDALLKGPAR
GGLCVCSRTEKNHPSQTFGENWGGKARSSEAEATHTACPGHTCKADTSRGDASAAERRRF
QRRRLQQHSQFFESEPRNGSNTRRGWLPGTIRVRLRERISTVQTSGERGSGVCRAGKRLE
RLDPETLFREFVEPHLSSRIYGPRGRKSGSTSTVVLYPGKKLVIGDLTFVVWATDPRNNP
GFVDENTSIYISLDPYGEFKRVHFVPFSDTLPTTYRFDFYDDYLKPFLLENTWRNFTRGD
VYSYRGVEFKLIATEPASCNIARVGPETIVHYQGSVEPTIMDLLPPDILQRIRRLPVRLQ
PFAIISAAQALDPQVLMRVIPAASIRGPRQGLSEQMVDVLRDRLVHPFSFAHYLHSFRDL
CERKLPSGAKPDDSPCKRNASPGSSKQQAAMGTTTHDRDPQKSARGDTNITHIIQQPSGV
EIERQTEQVKDDSASSTFAVRVQPESLSDALSSVSTPGHEGGPSDKRPPQEEEGNSDKSR
RNLEAVQGVEANSEAPLSPDHSETAEKPAWSMCVDEFERPSCTVCTLTLEEGDLSIILPC
GHVFHWQCAHAWLRCNSTCPNCRADINVLLQRDNGERSDSACASRMSSTRDRSRSDGQRT
EWHRRNRGDENDRQGGIGNAFRSWFSSILS
Download sequence
Identical sequences A0A139Y1U4 A0A151HK58 S8GHY4
gi|211966151|gb|EEB01347.1| gi|237838379|ref|XP_002368487.1| gb|TGME49_091030 XP_002368487.1.89292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]