SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gb|TGME49_095340 from Toxoplasma gondii ME49

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gb|TGME49_095340
Domain Number 1 Region: 247-311
Classification Level Classification E-value
Superfamily XPC-binding domain 9.42e-20
Family XPC-binding domain 0.00048
Further Details:      
 
Domain Number 2 Region: 1-85
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000161
Family Ubiquitin-related 0.002
Further Details:      
 
Domain Number 3 Region: 161-214
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000016
Family UBA domain 0.0026
Further Details:      
 
Domain Number 4 Region: 313-373
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000989
Family UBA domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gb|TGME49_095340
Sequence length 380
Comment | organism=Toxoplasma_gondii_ME49 | product=UV excision repair protein rhp23, putative | location=TGME49_chrIa:1812316-1817506(+) | length=380
Sequence
MKLRIRTLSNEEAELEVGAEETVLNVKEKVEQRWPHMPAARQKLVHAGKILADAQKIKDC
SALKENDRLVVMVTKAVSQPAVSSSTAASAAPASAASPSPAETQRGSSAAGSTAGDGESA
KSETPGGSGNASGNSGGPANPAHASSPSSAPDATSEGLSRAAAESALFTGPQLEETLTHL
VAMGFPRSQAEEAMRAAFNNPDRAVEYLMNGMPPEVSAMLGGDSAETQEAHGDVPPEEGD
AEGDEDDENPLGALRHHPAFNQIRQMVQANPAMLPQVLQLIGNSNPQLLELITQNQDAFL
EMLQSDQGEGETGAAGTGGFAAPGIIQMTAEEMEALQRLESLGFSRHQAVEAYLACDRNE
EMAANYLFENLNDLGDDAGD
Download sequence
Identical sequences A0A086JUB8 A0A086JY59 A0A086PJ19 A0A0F7UT30 A0A125YYY8 A0A125YYY9 A0A2G8XLG3 Q1JTK9
gb|TGME49_095340 gb|TGVEG_050540 gi|211969147|gb|EEB04343.1| gi|237844371|ref|XP_002371483.1| XP_018638523.1.89292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]