SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gb|TGGT1_016760 from Toxoplasma gondii GT1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gb|TGGT1_016760
Domain Number 1 Region: 1411-1478
Classification Level Classification E-value
Superfamily HMG-box 0.00000000000497
Family HMG-box 0.0024
Further Details:      
 
Domain Number 2 Region: 1128-1196
Classification Level Classification E-value
Superfamily HMG-box 0.000000537
Family HMG-box 0.0024
Further Details:      
 
Weak hits

Sequence:  gb|TGGT1_016760
Domain Number - Region: 2344-2388
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000187
Family Myb/SANT domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gb|TGGT1_016760
Sequence length 2519
Comment | organism=Toxoplasma_gondii_GT1 | product=conserved hypothetical protein | location=TGGT1_chrVIIa:2075375-2087196(+) | length=2519
Sequence
MPPGVSPSPNPSLLAGVEGPCPSSPDSRRTDASPVTFSFTYPSPSALFDPEKENESSYAP
CSSLFSAASHTRVPVKPGVQFDFDSSSQPSHLSSFAAPSLSFFRSCWLDVPGRKPAEEAQ
TVPVSSLPETDLFAPLALVASRASGCSSQISENATVACKNSKGRLRGGADREEATDTAVS
PVSGVLTAGPKERSLPAGTRPRDGIAAGETVSLDQERPCSSSRPPLSALSLLFSGQSSRQ
PRESGENLESVAPVCEAAFTFSSPLSVLPPAATVAGACTLTQGGSAWGCRPSGEDFPLRF
IPLLHAEPVRGGVEQAVPLDPGPLSWSSCPFVVDPLAFSLSSTLGDGVICSSLSADPAEA
LQTSAAALATALKFAAAAALLCSPKKRASGAASKGSASPLHPDGGEREREKELAFFQAFL
RETQLRRRRARQARREEETSALMPLGAATAASRKQHDDLYQAFHAAHRVAESWAERLSKD
VDFFGSRSVRQVSCGESEAHASFAAYKKETTSPAEKREGETLDCDRGSLQASRESGQTAQ
DGLQVLVEQWGTERVGRVSDKIPVGNIEQKETRKPSKGLDLECAFPAVKLSCRPSSAARA
VLYKALRGVANELTQAEELATHLREKTEPSSSATSSVPSPGAAPEEGDLAETKSSGSSAT
SYAPPAASDVSGPLSSQAPAFQAGDEESTERESDPLAAGVERGSASSFNFLEEAEEAEEA
QVQKLVKRAMLLRSLRDLLREHLSVSLPSGAPLSLSPTKRDPPSGPSSPAAAGPSAPASE
DATSDFFSEEKQRLERILSLLLRQVERHEDRQVHELLLSASTPKPVKQRLVQVLLAEVLA
EVSVTFHHERLRKLSPSVGSRKPSHGTLSMPVASERGRACLTSAGAAPASGKPGTQPGVS
GGPLAPASSPAGEGVLPAELAGPSPLSILQCLVRAQRAEAATAEVQAEVVAAGRAALLRL
AHLAPRLAACIPLLAPYLNHLPRLLHMQLQLLAQQAQRGELTTKGIEEKLLKHFRDQEAF
ACTPFFAALSQQLAECLAGSRPILPAPSLATVALAPGAATPQTLASGLLAPGAAAGPFFL
AQGAGGERGLASVGALAPRLAALGTAREDGKAANTPGGLAGKPPASAAAKKPSRKGMGMS
GWALFAKEKRAELQQEGTLEGETLPEQTSFVARFWHQLSKEKKAEWGRRAEELNRQAGLR
MKKEEEIRKMKEQAEAEEKKRAAAATVTGLSEAGLGGVPLQGPSGSLPQLKPALGAPMLH
HSLAPFTTAKNTLPGGAYPHPGPDDRAHQSLLPAGTPAGPATRVVHADGSVSFVGHTVSG
ASPSPAGGLPGDGVSPRAAQAGEEASQASSGFVRAPQPQGLATPFAVPGPLARPPQPPDG
MQSGVGADFPAAKKKSRSGGSGKKGEGQGKGGRGYTAFTFFAKEMRQKCKEEGIECGTSL
SEQNTFIGDKWRQVSPEEKKIFQQRAKEANEAWRREHEEKLLLAQQKEQEQAQKQETPAD
PSLAFAVPQAGATPSAGPPQMSVQAAGQLRSSSLPGSVACSVPVYGSPPQTGAYQLATGP
GHPTPSQGAQGGYPPQGPALQERRGEREGDAFGATASHLGLPHTVSGPQGRAPPESRGEL
GAPAPLPALHRGSTPFSGSPSSASLSAHAVAREEDGSRERVSALDSASPPLKKQRGDSED
APFFSARPGPGDPASAGAGRGSEAGEVHAGERERRGFYAAAPLPSNAHFGETGCPSVGDQ
DGAQRAEGRGAVGAVATPEPQWRREDDAFAVQSQLPAAQFTPPPASLPALPPRTSPFPCD
HTVGLRKPSLSAPPSAPGLGGLAAYPPEEVLYQLKFDSPLDVEEGRRDEDREERGGKMYG
GGDRDASDRTDFFVSEQVHSAPLPSRRSLRAAARGALEKGSSEGTGETGKETKGEEGVDA
SENEESEGDGAANSKEEEERDAETGDEERGARQGLRRDEGRRGRRGDHLTGGSAREEQQQ
VESPSSGRFGTRVRRGVSDRDGLRFEETERDQDEGDAETEEKDEEWEEEEGADDSSDEDF
EPASRRHFASAKKRLRKVPLPAAVEETGETPDPVRASGRAQRRSGGAARESKGAADEETE
VPARRNQGSRRKRTGSTERSKARARRRREEGKELLQLSLPASIVEKEGPLTLWDLIQRNK
RRPVSSAKGEQEAEAKAKAGASGENGGRDSQRHGELDESFDSVLGSLFSAPASFGQGTLG
GGDQALQALLSPSPTRKGRDEEEEGSAEKDLSALFDTPRQGSAPALRLDADGQLVMDERG
EEMEPPVCTCGASLGLFDALGQASAPCVCLFNGRRRLVEEGGPGGVNGLSLQPYAGAYKS
TKGKRWTPEETQRFYAALEQYGTDLLLVGTLLPHVTDKQLKLKLKIEERRCPEKVEAALR
RRRQLTTDAYEGMHGKINAALHYRRALGSSSSDDSDGESETRRPKAIADSPPISEPTLPS
APENSSSSSFPALLSILADASADGQTAADNTDVDPSLFALPVEGDITAGAGDDLLALFG
Download sequence
Identical sequences S7UUD4
gb|TGGT1_016760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]