SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gb|TGGT1_081710 from Toxoplasma gondii GT1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gb|TGGT1_081710
Domain Number 1 Region: 178-212
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000942
Family CCCH zinc finger 0.0026
Further Details:      
 
Domain Number 2 Region: 275-320
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000133
Family RING finger domain, C3HC4 0.02
Further Details:      
 
Weak hits

Sequence:  gb|TGGT1_081710
Domain Number - Region: 216-256
Classification Level Classification E-value
Superfamily EsxAB dimer-like 0.0811
Family ESAT-6 like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gb|TGGT1_081710
Sequence length 411
Comment | organism=Toxoplasma_gondii_GT1 | product=zinc finger (CCCH type) protein | location=TGGT1_chrX:1475671-1478906(+) | length=411
Sequence
MFAKRATKKQGRRGPLSEEAEAEATAGGSASGTQTTRAEKDERQSDKDDEDPVHVVKKQR
TASTGKHFIQAVSERTKHTAEEMLHGFKSNPKLTINNDNRATAIFDVDTDRKHDHRAILE
RNAEIGEKIEKGELEAGIYRGQGAHRVYVKRREGALSFAKSTGLYGPVRGTNNVRMTMYV
DYNPEICKDYKETGYCGFGNTCKFLHDRHDYKGGWQIEQEWQQLQKKKQAIFRLLIDFQE
KLRRIAEGLADSDEDTDKSSDSSEASEDEDGLPFACLKCRKKWTENMNPVVTRCGHYFCE
TCAYTHYSTSIKCYQCGKETQGIFNSAFDLLRKVKNIEMDRERKAQRRKQRRANERGEAD
SDESNMENDAKSSQSGEDEEGNSDAGSKEDGSGNTSDEEGGEDGRGNDSDE
Download sequence
Identical sequences A0A0F7V5I5
gb|TGGT1_081710 gi|211963973|gb|EEA99168.1| gi|237834023|ref|XP_002366309.1| gb|TGVEG_067620 gb|TGME49_026560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]