SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Mucci1|87011|estExt_fgeneshMC_pm.C_10118 from Mucor circinelloides

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Mucci1|87011|estExt_fgeneshMC_pm.C_10118
Domain Number - Region: 67-107
Classification Level Classification E-value
Superfamily Sialidases 0.00104
Family Sialidases (neuraminidases) 0.036
Further Details:      
 
Domain Number - Region: 12-102
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0012
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Mucci1|87011|estExt_fgeneshMC_pm.C_10118
Sequence length 163
Sequence
MANGFTGGYMGFQHNSGTERRILFSVWDDGKGSTVDVLKKGDGVIAKGFGGEGTGSQSYK
VYNWKAQDTVYFKVTSDVNEAKSETTLSGYYSTDGGKTWNLMATFLAHKQKIYLSSPYGF
LENFGSDQSTLKEGFYGNQTITSTSGKVAHIIYELWEMRHQDL
Download sequence
Identical sequences jgi|Mucci1|87011|estExt_fgeneshMC_pm.C_10118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]