SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for psu|NCLIV_035760 from Neospora caninum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|NCLIV_035760
Domain Number 1 Region: 40-160
Classification Level Classification E-value
Superfamily Major surface antigen p30, SAG1 0.0000000111
Family Major surface antigen p30, SAG1 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) psu|NCLIV_035760
Sequence length 193
Comment | organism=Neospora_caninum | product=SRS domain-containing protein,SRS34A, putative | location=NCLIV_chrVIII:4549846-4550427(+) | length=193
Sequence
MNFCKISCRAPLALKAVAGVFVLVNYALMSNASEMAAPIQCASGETKEIQAPTSGSIVFQ
CGANLQLTPTDGAVFQGEECTEQTKLDSLVPGANLVTKAQKSKSASPTYTLTFDDTPPEA
QVLCYKCVAPTADAGGSGRSEAQGGAEQAQKECKLIINVPGVEGLVTSSGSVSASLTRKC
LAAVLAGLLIALP
Download sequence
Identical sequences F0VJ84
psu|NCLIV_035760 psu|NCLIV_035760 XP_003883827.1.31604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]