SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for psu|NCLIV_046140 from Neospora caninum

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  psu|NCLIV_046140
Domain Number - Region: 47-154
Classification Level Classification E-value
Superfamily Major surface antigen p30, SAG1 0.00194
Family Major surface antigen p30, SAG1 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) psu|NCLIV_046140
Sequence length 213
Comment | organism=Neospora_caninum | product=hypothetical protein, conserved | location=NCLIV_chrX:1121504-1122145(-) | length=213
Sequence
MACRGTLSVRQWAVSLCIFVALAGESRFCTGAQGTVFDAVIDVEHPKHLSVSMRYGDQMR
FFCKGATAIIPQAFKSKCCNAYRAICTPGNIESEYSGMFPLADEGFSFWSAGDGVNAAAM
FTLPPQKNGNRYETRFSLGCVGARNQVSAVDVTIAASGYNLREHFEDAMKKPVHDEEEKN
PQTVTESGVGADVLSPLGLLVSILTLASVSQTL
Download sequence
Identical sequences F0VLQ4
psu|NCLIV_046140 psu|NCLIV_046140 XP_003884213.1.31604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]