SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for psu|NCLIV_046420 from Neospora caninum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|NCLIV_046420
Domain Number 1 Region: 179-213
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000157
Family CCCH zinc finger 0.0026
Further Details:      
 
Domain Number 2 Region: 281-326
Classification Level Classification E-value
Superfamily RING/U-box 0.000000019
Family RING finger domain, C3HC4 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) psu|NCLIV_046420
Sequence length 597
Comment | organism=Neospora_caninum | product=Pre-mRNA-splicing factor CWC24, related | location=NCLIV_chrX:1362592-1368380(+) | length=597
Sequence
MFAKRATKKQGRRGPLSEEAEAEAAAGDSPPNTETARAQRDEERPSDKDDDDSVKPIKKQ
RTTPTGKHFIQAVSERRKHTAEETLHGFKSNPKLALHNDNRATAVFDVDTDKAHDHRAIL
ERNAEISDKIEKGELEAGIYRGQGAHRVYVKRREGALSYAKTTGLYGPVRGTNNVRMTMY
VDYNPEICKDYKETGYCGFGNTCKFLHDRHDYKGGWQIEQEWQQLQKKKQASEDAETECG
SGQEPEKLRRIAEGLVDSDEDTDKSSDSSEASEDEEGLPFACLKCRKKWTEDMNPVVTRC
GHYFCETCAYAHYSTSIKCYQCGKETQGIFNAAFDLLKKVKNIEQDRQRKAQRRKQRRAS
EMGGGDSNEESDLEKDAKSSQSEEEDAESSSQVSSKKHGNGDSSGEEGDQAAGRGSEGEE
GSEDERGDDSDGSNSCGYRLAPKCFGQLHTMIGSEDFWRTEADAPLLNRNADFVKQENAQ
EMIARARKLVDLVESGAGTDPDLVATKDVSKTLAVLRLDQSLYPNTKQAEGSDEPGSFFT
RIVEDAIDFDLGDADIEKLREQALEEMRLEEEKRKEREKQLGLDSDDEIVFSDEEDE
Download sequence
Identical sequences psu|NCLIV_046420 psu|NCLIV_046420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]