SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A009HM12 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A009HM12
Domain Number - Region: 19-43
Classification Level Classification E-value
Superfamily Copper amine oxidase, domain N 0.0366
Family Copper amine oxidase, domain N 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A009HM12
Sequence length 183
Comment (tr|A0A009HM12|A0A009HM12_ACIBA) Antirepressor domain protein {ECO:0000313|EMBL:EXB05202.1} KW=Complete proteome OX=1310613 OS=Acinetobacter baumannii 1295743. GN=J512_2412 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence
MNMVAQPQTVFFHNTQLSIVEYNNQPYVPMKLVVEGMGLDWKSQYRKIAKKFKTCMVKMT
IQLFGDSQSREVVMLPLRKLPAWLYSVEPNKVKPELRDTVIKYQEECDDVLWNHWTGKLN
ARHKAFDELNAIDMDEKISKAKATLHSHGLHLRKAEKKTNKQKRQDWINKNTLLLNFGEE
GLA
Download sequence
Identical sequences A0A009HM12 A0A265AFH8
WP_032051275.1.102029 WP_032051275.1.47917 WP_032051275.1.97651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]