SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A009HNI9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A009HNI9
Domain Number - Region: 48-108
Classification Level Classification E-value
Superfamily BH3703-like 0.0196
Family BH3703-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A009HNI9
Sequence length 181
Comment (tr|A0A009HNI9|A0A009HNI9_ACIBA) Uncharacterized protein {ECO:0000313|EMBL:EXB05732.1} KW=Complete proteome OX=1310613 OS=Acinetobacter baumannii 1295743. GN=J512_1935 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence
MSSENESNAKEREKFEKFMMSNSRGLPPLVEDTSNGSVVWKSLDNINYEELGYFLSCHLI
IEHYMDEYLKFEYQNLSWGDCKLTFSQKINLLSNFPISEPYKELILSIKAMNKVRNKISH
RVDFKISMDDLEPLKYYLYGAYKENKEMVPSTVLKLLEIYTMMVCVVFASTISALVRHKS
K
Download sequence
Identical sequences A0A009HNI9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]