SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A009IKC8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A009IKC8
Domain Number 1 Region: 29-177
Classification Level Classification E-value
Superfamily LigT-like 0.00000000541
Family tRNA splicing product Appr>p cyclic nucleotide phosphodiesterase 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A009IKC8
Sequence length 208
Comment (tr|A0A009IKC8|A0A009IKC8_ACIBA) 2'-5' RNA ligase superfamily protein {ECO:0000313|EMBL:EXB05169.1} KW=Complete proteome OX=1310613 OS=Acinetobacter baumannii 1295743. GN=J512_2491 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence
MVPTPIRDYPEWHLGRQNYALWYLEINDQKLVHYLDQLRAHFSEFLVEPNHRQYHVTLFI
CGFLTHETKVHCDDFSFTEFEQHKKVLIQENFAPFQLKIGSVDSFSSALFVEVQDTENIL
SLIRQKLGTVSNEIAALDYCPHITLGLYKKDYSSNLILQKISQLPVQYTQAEFDLKVEHL
SFGYYQAQILQGQLYPYQHLFLGDSCCN
Download sequence
Identical sequences A0A009IKC8 A0A009JPD5
WP_032028372.1.47917 WP_032028372.1.81294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]