SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A009K2V0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A009K2V0
Domain Number - Region: 141-215
Classification Level Classification E-value
Superfamily Serpins 0.0222
Family Serpins 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A009K2V0
Sequence length 226
Comment (tr|A0A009K2V0|A0A009K2V0_ACIBA) Uncharacterized protein {ECO:0000313|EMBL:EXB36282.1} KW=Complete proteome OX=1310619 OS=Acinetobacter baumannii 1419130. GN=J518_0221 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence
MLKKIMHEAVKDSGFILEKSSDNTNFFIKENGGAQRYLIVHVLDQLLSVESIHKLINESL
PDKMQKQPAFKKNCDLIIIYKVNFLNDFNEIEEQVLEIEENPFYFKKYFFYYSDAEEKLL
LGKSYEDFKSQIKKMDEFDEYKKDPLKPSFHSLVTRLFIKFPFLEIPKFSKSFQNLFDSV
SEKVNAENLVKTYDLIGKYEADSIDEVIAELLSEELENIKASDSSI
Download sequence
Identical sequences A0A009K2V0
WP_032027699.1.73683 WP_032027699.1.81294 WP_032027699.1.93851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]