SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A009LA93 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A009LA93
Domain Number 1 Region: 23-162
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000183
Family SMI1/KNR4-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A009LA93
Sequence length 189
Comment (tr|A0A009LA93|A0A009LA93_ACIBA) Uncharacterized protein {ECO:0000313|EMBL:EXB49182.1} KW=Complete proteome OX=1310623 OS=Acinetobacter baumannii 146457. GN=J522_0761 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence
MVDFVSELISCRHEDTHLPLYPEHIQGYTEQEINQIAEIYNLKIHGQFREFLLQMGRCSG
GLLWGDSVLMYGPAWEKQKYKDLQQTFIKDEIANPTKGMIDAIENKLFFLTMENECCFFT
YLATAREDGRNSVWALDDGQPESEFSSTGSTLLEYLRWLVKYETKQARFEKKVVNFKQDK
KYITGRLLD
Download sequence
Identical sequences A0A009LA93
WP_032867445.1.86756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]