SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A009LKK8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A009LKK8
Domain Number 1 Region: 1-112
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 6.93e-38
Family N-utilization substance G protein NusG, N-terminal domain 0.00014
Further Details:      
 
Domain Number 2 Region: 120-175
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.00000000000000677
Family N-utilization substance G protein NusG, C-terminal domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A009LKK8
Sequence length 177
Comment (tr|A0A009LKK8|A0A009LKK8_ACIBA) Transcription termination/antitermination protein NusG {ECO:0000256|HAMAP-Rule:MF_00948, ECO:0000256|RuleBase:RU000538, ECO:0000256|SAAS:SAAS00126873} KW=Complete proteome OX=1310623 OS=Acinetobacter baumannii 146457. GN=J522_3224 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence
MKRWYIIHAYSGFEKQVMRSLNDRIQRSTVADSFGEVLVPTEEVVEMKDGKKRKSERKFF
PGYVLVEMEMNDDTWHIVKECPKVLGFIGGTPEKPAPISQREADAILARVRNTGEAPRPK
TMFEPGEELLVVDGPFTDFKGVVEEVQYDKSRLTLTINVFNRPTQVELEFRQVEKTI
Download sequence
Identical sequences A0A009J7W0 A0A009LKK8 A0A022IFS4 A0A0B0KPK2 K9BDR9 N8UT04 N9MP96 N9Q1K4 N9Q4Q7
WP_004774016.1.24249 WP_004774016.1.32973 WP_004774016.1.35252 WP_004774016.1.35691 WP_004774016.1.37375 WP_004774016.1.38280 WP_004774016.1.53563 WP_004774016.1.55814 WP_004774016.1.86756 WP_004774016.1.88139 WP_004774016.1.9021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]