SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A009LN26 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A009LN26
Domain Number - Region: 33-101
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0388
Family SMI1/KNR4-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A009LN26
Sequence length 229
Comment (tr|A0A009LN26|A0A009LN26_ACIBA) GAD-like domain protein {ECO:0000313|EMBL:EXB48545.1} KW=Complete proteome OX=1310623 OS=Acinetobacter baumannii 146457. GN=J522_0115 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence
MTEKYVMDEAFDYFYNDEGFGPPIDSISVSEEILAKFKGKLPNQILEYWKAFGFSGWGNG
LFWLVNPDDYQDVLDAWLEHVELPSHEEYFVIARTAFGDLSVWGTIHGRCLTISSTTSQI
FPKMEPSSQEDWDSLIRTFILVQEKDNLDINDWKNKPLFDRAVKKYGVLKPNEMFGFEPA
LILGGEAKLENVRKLPIISHLQLLASLDTPRMMLDIGKFVDEQGLGKDD
Download sequence
Identical sequences A0A009LN26 A0A022ISH0
WP_032866479.1.55814 WP_032866479.1.86756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]